GR402428
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR402428 vs. SwissProt
Match: TRP4_ARATH (Telomere repeat-binding protein 4 OS=Arabidopsis thaliana GN=TRP4 PE=1 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 3.025e-20 Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA ISPQQRRG+PVPQELL+RVL AH +W+ HQ KQ+ K Sbjct: 571 HRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLGAHRYWTQHQMKQNGK 625
BLAST of GR402428 vs. SwissProt
Match: TRP5_ARATH (Telomere repeat-binding protein 5 OS=Arabidopsis thaliana GN=TRP5 PE=1 SV=2) HSP 1 Score: 95.5153 bits (236), Expect = 8.802e-20 Identity = 42/54 (77.78%), Postives = 48/54 (88.89%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHV 162 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS Q K + Sbjct: 564 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLTAHAYWSQQQGKHQL 617
BLAST of GR402428 vs. SwissProt
Match: TRP1_ARATH (Telomere repeat-binding protein 1 OS=Arabidopsis thaliana GN=TRP1 PE=1 SV=2) HSP 1 Score: 95.1301 bits (235), Expect = 1.150e-19 Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIKPM 180 H+TYVDLKDKWKTLVHTAKISPQQRRG+PVPQELLNRVL AH +W+ Q +Q +++ + Sbjct: 504 HRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNVNKL 563
BLAST of GR402428 vs. SwissProt
Match: TRP2_ARATH (Telomere repeat-binding protein 2 OS=Arabidopsis thaliana GN=TRP2 PE=1 SV=1) HSP 1 Score: 94.3597 bits (233), Expect = 1.961e-19 Identity = 42/52 (80.77%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQ 156 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS H Q Sbjct: 489 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLKAHAYWSQHLMHQ 540
BLAST of GR402428 vs. SwissProt
Match: TRP3_ARATH (Telomere repeat-binding protein 3 OS=Arabidopsis thaliana GN=TRP3 PE=1 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 2.561e-19 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA ISPQQRRG+PVPQELL+RVL A+ +WS HQ K + Sbjct: 545 HRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLRAYGYWSQHQGKHQAR 599
BLAST of GR402428 vs. SwissProt
Match: TBP1_ORYSJ (Telomere-binding protein 1 OS=Oryza sativa subsp. japonica GN=TBP1 PE=1 SV=2) HSP 1 Score: 93.9745 bits (232), Expect = 2.561e-19 Identity = 43/53 (81.13%), Postives = 47/53 (88.68%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQH 159 H+TYVDLKDKWKTLVHTA I+PQQRRG PVPQELL+RVLAA A+WS QAK H Sbjct: 570 HRTYVDLKDKWKTLVHTASIAPQQRRGAPVPQELLDRVLAAQAYWSEQQAKLH 622
BLAST of GR402428 vs. SwissProt
Match: TRP6_ARATH (Telomere repeat-binding protein 6 OS=Arabidopsis thaliana GN=TRP6 PE=1 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 3.698e-18 Identity = 40/46 (86.96%), Postives = 45/46 (97.83%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWS 138 H+TYVDLKDKWKTLVHTAKIS +QRRG+PVPQ+LL+RVLAAHAFWS Sbjct: 351 HRTYVDLKDKWKTLVHTAKISARQRRGEPVPQDLLDRVLAAHAFWS 396
BLAST of GR402428 vs. TrEMBL
Match: B9HMJ1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_656113 PE=4 SV=1) HSP 1 Score: 106.686 bits (265), Expect = 8.043e-22 Identity = 47/56 (83.93%), Postives = 54/56 (96.43%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKS 168 H+TYVDLKDKWKTLVHTA+I+PQQRRG+PVPQELL+RVLAAHA+WS HQAKQH K+ Sbjct: 177 HRTYVDLKDKWKTLVHTARIAPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHSKN 232
BLAST of GR402428 vs. TrEMBL
Match: B9HTH4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_659670 PE=4 SV=1) HSP 1 Score: 106.301 bits (264), Expect = 1.050e-21 Identity = 47/56 (83.93%), Postives = 54/56 (96.43%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKS 168 H+TYVDLKDKWKTLVHTA+I+PQQRRG+PVPQELL+RVLAAHA+WS HQAKQH K+ Sbjct: 200 HRTYVDLKDKWKTLVHTAQIAPQQRRGEPVPQELLDRVLAAHAYWSQHQAKQHSKN 255
BLAST of GR402428 vs. TrEMBL
Match: D7TLS4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_19.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00016524001 PE=4 SV=1) HSP 1 Score: 104.375 bits (259), Expect = 3.992e-21 Identity = 46/55 (83.64%), Postives = 53/55 (96.36%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQE+L+RVL+AHA+WS HQAKQH K Sbjct: 605 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGK 659
BLAST of GR402428 vs. TrEMBL
Match: A5BV88_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021864 PE=4 SV=1) HSP 1 Score: 104.375 bits (259), Expect = 3.992e-21 Identity = 46/55 (83.64%), Postives = 53/55 (96.36%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQE+L+RVL+AHA+WS HQAKQH K Sbjct: 596 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQEVLDRVLSAHAYWSEHQAKQHGK 650
BLAST of GR402428 vs. TrEMBL
Match: Q84ZU4_NICGU (Telomere binding protein TBP1 OS=Nicotiana glutinosa PE=1 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 1.161e-20 Identity = 45/58 (77.59%), Postives = 53/58 (91.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIK 174 H+TYVDLKDKWKTLVHTA I+PQQRRG+PVPQ+LL+RVLAAHA+WS Q KQHV+ +K Sbjct: 613 HRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQQGKQHVEPLK 670
BLAST of GR402428 vs. TrEMBL
Match: Q08707_PETCR (BPF-1 protein OS=Petroselinum crispum GN=BPF-1 PE=2 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 1.161e-20 Identity = 45/55 (81.82%), Postives = 52/55 (94.55%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA I+PQQRRG+PVPQ+LL+RVLAAHA+WS HQ+KQH K Sbjct: 620 HRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQHQSKQHGK 674
BLAST of GR402428 vs. TrEMBL
Match: B9T8J2_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0352020 PE=4 SV=1) HSP 1 Score: 102.834 bits (255), Expect = 1.161e-20 Identity = 46/59 (77.97%), Postives = 53/59 (89.83%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIKP 177 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS QAKQ +K +P Sbjct: 624 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKQQQP 682
BLAST of GR402428 vs. TrEMBL
Match: Q9FNS1_CATRO (MYB-like DNA-binding protein OS=Catharanthus roseus GN=bpf-1 PE=2 SV=1) HSP 1 Score: 102.449 bits (254), Expect = 1.517e-20 Identity = 48/64 (75.00%), Postives = 56/64 (87.50%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQ----HVKSIKPM 180 H+TYVDLKDKWKTLVHTA ISPQQRRG+PVPQELL+RVL+AHA+WS HQ+KQ HV+ +K M Sbjct: 625 HRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLSAHAYWSQHQSKQTGKHHVEPLKIM 688
BLAST of GR402428 vs. TrEMBL
Match: A0ZPR8_TOBAC (Telomere binding protein (Fragment) OS=Nicotiana tabacum GN=NtTBP1 PE=2 SV=1) HSP 1 Score: 102.449 bits (254), Expect = 1.517e-20 Identity = 45/58 (77.59%), Postives = 53/58 (91.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIK 174 H+TYVDLKDKWKTLVHTA I+PQQRRG+PVPQ+LL+RVLAAHA+WS Q KQHV+ +K Sbjct: 159 HRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQQRKQHVEPLK 216
BLAST of GR402428 vs. TrEMBL
Match: B9HPG4_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_203733 PE=4 SV=1) HSP 1 Score: 101.679 bits (252), Expect = 2.587e-20 Identity = 46/55 (83.64%), Postives = 51/55 (92.73%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVLAAHA+WS QAKQ K Sbjct: 618 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLAAHAYWSQQQAKQQFK 672
BLAST of GR402428 vs. TAIR peptide
Match: AT5G13820.1 (| Symbols: TBP1, ATBP-1, ATBP1, ATTBP1, HPPBF-1 | telomeric DNA binding protein 1 | chr5:4461694-4464355 FORWARD LENGTH=640) HSP 1 Score: 97.0561 bits (240), Expect = 2.425e-21 Identity = 43/55 (78.18%), Postives = 49/55 (89.09%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA ISPQQRRG+PVPQELL+RVL AH +W+ HQ KQ+ K Sbjct: 571 HRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLGAHRYWTQHQMKQNGK 625
BLAST of GR402428 vs. TAIR peptide
Match: AT1G07540.1 (| Symbols: TRFL2 | TRF-like 2 | chr1:2318433-2321048 REVERSE LENGTH=630) HSP 1 Score: 95.5153 bits (236), Expect = 7.055e-21 Identity = 42/54 (77.78%), Postives = 48/54 (88.89%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHV 162 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS Q K + Sbjct: 564 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLTAHAYWSQQQGKHQL 617
BLAST of GR402428 vs. TAIR peptide
Match: AT5G59430.4 (| Symbols: ATTRP1 | telomeric repeat binding protein 1 | chr5:23968254-23970695 FORWARD LENGTH=577) HSP 1 Score: 95.1301 bits (235), Expect = 9.214e-21 Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIKPM 180 H+TYVDLKDKWKTLVHTAKISPQQRRG+PVPQELLNRVL AH +W+ Q +Q +++ + Sbjct: 503 HRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNVNKL 562
BLAST of GR402428 vs. TAIR peptide
Match: AT5G59430.2 (| Symbols: ATTRP1 | telomeric repeat binding protein 1 | chr5:23968254-23970695 FORWARD LENGTH=578) HSP 1 Score: 95.1301 bits (235), Expect = 9.214e-21 Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIKPM 180 H+TYVDLKDKWKTLVHTAKISPQQRRG+PVPQELLNRVL AH +W+ Q +Q +++ + Sbjct: 504 HRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNVNKL 563
BLAST of GR402428 vs. TAIR peptide
Match: AT5G59430.1 (| Symbols: ATTRP1, TRP1 | telomeric repeat binding protein 1 | chr5:23968254-23970695 FORWARD LENGTH=578) HSP 1 Score: 95.1301 bits (235), Expect = 9.214e-21 Identity = 42/60 (70.00%), Postives = 51/60 (85.00%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVKSIKPM 180 H+TYVDLKDKWKTLVHTAKISPQQRRG+PVPQELLNRVL AH +W+ Q +Q +++ + Sbjct: 504 HRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWTQQQMQQLQQNVNKL 563
BLAST of GR402428 vs. TAIR peptide
Match: AT3G46590.3 (| Symbols: TRFL1, ATTRP2 | TRF-like 1 | chr3:17153642-17155946 FORWARD LENGTH=547) HSP 1 Score: 94.3597 bits (233), Expect = 1.572e-20 Identity = 42/52 (80.77%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQ 156 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS H Q Sbjct: 483 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLKAHAYWSQHLMHQ 534
BLAST of GR402428 vs. TAIR peptide
Match: AT3G46590.2 (| Symbols: TRFL1, ATTRP2 | TRF-like 1 | chr3:17153642-17155946 FORWARD LENGTH=553) HSP 1 Score: 94.3597 bits (233), Expect = 1.572e-20 Identity = 42/52 (80.77%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQ 156 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS H Q Sbjct: 489 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLKAHAYWSQHLMHQ 540
BLAST of GR402428 vs. TAIR peptide
Match: AT3G46590.1 (| Symbols: TRFL1, ATTRP2, TRP2 | TRF-like 1 | chr3:17153642-17155946 FORWARD LENGTH=552) HSP 1 Score: 94.3597 bits (233), Expect = 1.572e-20 Identity = 42/52 (80.77%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQ 156 H+TYVDLKDKWKTLVHTA+ISPQQRRG+PVPQELL+RVL AHA+WS H Q Sbjct: 488 HRTYVDLKDKWKTLVHTARISPQQRRGEPVPQELLDRVLKAHAYWSQHLMHQ 539
BLAST of GR402428 vs. TAIR peptide
Match: AT3G12560.1 (| Symbols: TRFL9, ATTBP2 | TRF-like 9 | chr3:3982272-3984848 REVERSE LENGTH=619) HSP 1 Score: 93.9745 bits (232), Expect = 2.053e-20 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHVK 165 H+TYVDLKDKWKTLVHTA ISPQQRRG+PVPQELL+RVL A+ +WS HQ K + Sbjct: 545 HRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLRAYGYWSQHQGKHQAR 599
BLAST of GR402428 vs. TAIR peptide
Match: AT5G59430.3 (| Symbols: ATTRP1 | telomeric repeat binding protein 1 | chr5:23968254-23970753 FORWARD LENGTH=568) HSP 1 Score: 93.5893 bits (231), Expect = 2.681e-20 Identity = 43/54 (79.63%), Postives = 48/54 (88.89%), Query Frame = 1 Query: 1 HKTYVDLKDKWKTLVHTAKISPQQRRGQPVPQELLNRVLAAHAFWSLHQAKQHV 162 H+TYVDLKDKWKTLVHTAKISPQQRRG+PVPQELLNRVL AH +W+ Q QH+ Sbjct: 504 HRTYVDLKDKWKTLVHTAKISPQQRRGEPVPQELLNRVLNAHGYWT-QQQMQHL 556 The following BLAST results are available for this feature:
BLAST of GR402428 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 7
BLAST of GR402428 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of GR402428 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR402428 ID=GR402428; Name=GR402428; organism=Cicer arietinum; type=EST; length=181bpback to top |