HO062804
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO062804 vs. SwissProt
Match: APX1_ORYSJ (L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 8.973e-7 Identity = 29/45 (64.44%), Postives = 30/45 (66.67%), Query Frame = -2 Query: 207 PSDKALLSDPVFRPLVEKXXXXXXXXXXXXXXAHLKLSELGFAEA 341 PSDKALLSDP FRPLVEK AHLKLSELGFA+A Sbjct: 206 PSDKALLSDPAFRPLVEKYAADEKAFFEDYKEAHLKLSELGFADA 250
BLAST of HO062804 vs. TrEMBL
Match: Q9LKG6_ASTPN (Ascorbate peroxidase (Fragment) OS=Astragalus penduliflorus PE=2 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 6.487e-8 Identity = 29/45 (64.44%), Postives = 30/45 (66.67%), Query Frame = -2 Query: 207 PSDKALLSDPVFRPLVEKXXXXXXXXXXXXXXAHLKLSELGFAEA 341 PSDKALL+DPVFRPLVEK AH KLSELGFAEA Sbjct: 79 PSDKALLTDPVFRPLVEKYAADEDAFFADYAVAHQKLSELGFAEA 123 HSP 2 Score: 28.4906 bits (62), Expect = 6.487e-8 Identity = 21/48 (43.75%), Postives = 31/48 (64.58%), Query Frame = -1 Query: 430 KGFTH*RECFGQGLGG*ANQEYWWLWSGGSTPIGSCNTKEAFLGFGGP 573 KG H R+ FG+G+ G ++Q+ L SGG T IG+ + + + GFGGP Sbjct: 9 KGSDHLRDVFGKGM-GLSDQDIVAL-SGGHT-IGAAHKERS--GFGGP 51 The following BLAST results are available for this feature:
BLAST of HO062804 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of HO062804 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO062804 ID=HO062804; Name=HO062804; organism=Cicer arietinum; type=EST; length=672bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|