GR399167
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR399167 vs. TrEMBL
Match: B9H4K5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_652029 PE=4 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 3.333e-12 Identity = 36/40 (90.00%), Postives = 37/40 (92.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVGEKVD+ GSGKSEV LSAVLQKP R Sbjct: 380 RLIERFGYKKLKWVVGEKVDTAGSGKSEVYLSAVLQKPAR 419
BLAST of GR399167 vs. TrEMBL
Match: Q8GT90_PRUPE (Putative uncharacterized protein OS=Prunus persica PE=4 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.267e-11 Identity = 35/40 (87.50%), Postives = 37/40 (92.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVG+KVD+ SGKSEV LSAVLQKPVR Sbjct: 381 RLIERFGYKKLKWVVGDKVDAAASGKSEVYLSAVLQKPVR 420
BLAST of GR399167 vs. TrEMBL
Match: B9R864_RICCO (ATRAD3, putative OS=Ricinus communis GN=RCOM_1597110 PE=4 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 1.267e-11 Identity = 34/40 (85.00%), Postives = 37/40 (92.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RL+ERFGYKKLKWVVGEKVD+ GSGKSE+ LSAVLQKP R Sbjct: 450 RLLERFGYKKLKWVVGEKVDTAGSGKSELYLSAVLQKPAR 489
BLAST of GR399167 vs. TrEMBL
Match: B9GQX8_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_643000 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 3.686e-11 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERF YKKLKWVVGEK+D+ GSGKSEV LSAVLQKP R Sbjct: 380 RLIERFQYKKLKWVVGEKIDTAGSGKSEVYLSAVLQKPAR 419
BLAST of GR399167 vs. TrEMBL
Match: Q949J6_SOLLC (Putative uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.078e-10 Identity = 34/39 (87.18%), Postives = 36/39 (92.31%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPV 124 RLIERFGYKKLKWVVGEK++ GSGKSEV LSAVLQKPV Sbjct: 298 RLIERFGYKKLKWVVGEKIN--GSGKSEVYLSAVLQKPV 334
BLAST of GR399167 vs. TrEMBL
Match: Q9FKS3_ARATH (At5g40830 OS=Arabidopsis thaliana GN=At5g40830 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.193e-7 Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVGEK D +EV LSAVLQKP R Sbjct: 380 RLIERFGYKKLKWVVGEKTD------AEVFLSAVLQKPAR 413
BLAST of GR399167 vs. TrEMBL
Match: D7LLY3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_904944 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.193e-7 Identity = 29/40 (72.50%), Postives = 32/40 (80.00%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWV+GEK D ++V LSAVLQKPVR Sbjct: 376 RLIERFGYKKLKWVIGEKAD------AQVYLSAVLQKPVR 409
BLAST of GR399167 vs. TrEMBL
Match: C0Z305_ARATH (AT5G40830 protein OS=Arabidopsis thaliana GN=AT5G40830 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.193e-7 Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVGEK D +EV LSAVLQKP R Sbjct: 340 RLIERFGYKKLKWVVGEKTD------AEVFLSAVLQKPAR 373
BLAST of GR399167 vs. TAIR peptide
Match: AT5G40830.2 (| Symbols: | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:16354611-16355855 REVERSE LENGTH=414) HSP 1 Score: 56.9954 bits (136), Expect = 4.631e-9 Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVGEK D +EV LSAVLQKP R Sbjct: 380 RLIERFGYKKLKWVVGEKTD------AEVFLSAVLQKPAR 413
BLAST of GR399167 vs. TAIR peptide
Match: AT5G40830.1 (| Symbols: | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr5:16354611-16355855 REVERSE LENGTH=414) HSP 1 Score: 56.9954 bits (136), Expect = 4.631e-9 Identity = 30/40 (75.00%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 RLIERFGYKKLKWVVGEK D +EV LSAVLQKP R Sbjct: 380 RLIERFGYKKLKWVVGEKTD------AEVFLSAVLQKPAR 413
BLAST of GR399167 vs. TAIR peptide
Match: AT3G27230.1 (| Symbols: | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr3:10054224-10055456 FORWARD LENGTH=410) HSP 1 Score: 56.225 bits (134), Expect = 7.900e-9 Identity = 28/40 (70.00%), Postives = 32/40 (80.00%), Query Frame = 2 Query: 8 RLIERFGYKKLKWVVGEKVDSVGSGKSEVVLSAVLQKPVR 127 R+IERFGYKKLKWV+GEK D ++V LSAVLQKPVR Sbjct: 376 RMIERFGYKKLKWVIGEKAD------AQVYLSAVLQKPVR 409 The following BLAST results are available for this feature:
BLAST of GR399167 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 8
BLAST of GR399167 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR399167 ID=GR399167; Name=GR399167; organism=Cicer arietinum; type=EST; length=431bpback to top |