GR398882
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR398882 vs. TrEMBL
Match: C1K3M7_VIGUN (Defensin OS=Vigna unguiculata GN=PDEF PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.130e-11 Identity = 37/55 (67.27%), Postives = 42/55 (76.36%), Query Frame = -1 Query: 282 MARSIPMVSPIFVFLLLLVASEMVP----EARSSESKIHNFTGPCGRDRNCASVC 434 MARS+P+VS IFVFLLLLVA+EM P EAR+ ES+ H F GPC D NCASVC Sbjct: 1 MARSVPLVSTIFVFLLLLVATEMGPTMVAEARTCESQSHRFKGPCVSDTNCASVC 55
BLAST of GR398882 vs. TrEMBL
Match: Q39807_SOYBN (Protease inhibitor OS=Glycine max PE=4 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.292e-8 Identity = 33/56 (58.93%), Postives = 39/56 (69.64%), Query Frame = -1 Query: 282 MARSIPMVSPIFVFLLLLVASEM-----VPEARSSESKIHNFTGPCGRDRNCASVC 434 M+RS+P+VS I V LLLLVA+EM V EAR+ ES+ H F GPC D NC SVC Sbjct: 1 MSRSVPLVSTICVLLLLLVATEMMGPTMVAEARTCESQSHRFKGPCLSDTNCGSVC 56
BLAST of GR398882 vs. TrEMBL
Match: Q945D8_CASSA (Putative gamma-thionin OS=Castanea sativa PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.429e-7 Identity = 31/55 (56.36%), Postives = 39/55 (70.91%), Query Frame = -1 Query: 282 MARSIPMVSPIFVFLLLLVASE----MVPEARSSESKIHNFTGPCGRDRNCASVC 434 M+RS+ + S +FV LLLLVA++ MV EAR+ ES+ H F GPC R NCASVC Sbjct: 1 MSRSMRVFSTVFVVLLLLVATQYMGPMVAEARTCESQSHRFKGPCVRKSNCASVC 55 The following BLAST results are available for this feature:
BLAST of GR398882 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR398882 ID=GR398882; Name=GR398882; organism=Cicer arietinum; type=EST; length=479bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|