HO664150
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO664150 vs. TrEMBL
Match: C6SYK6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.306e-12 Identity = 37/57 (64.91%), Postives = 44/57 (77.19%), Query Frame = 2 Query: 65 RVKTHEALSL*FQLPTVLTKNENNNLSFSQKENRIRELGQASTAKNYVEKNKRLLRD 235 R KT EA+SL +LP LT+N+ N+SFSQKE R RELGQAS KNYVE+ KRLLR+ Sbjct: 98 RKKTREAISLGEELPAALTRNDKKNISFSQKEKRKRELGQASRGKNYVEEEKRLLRE 154
BLAST of HO664150 vs. TrEMBL
Match: D7TE03_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_151.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00001191001 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.600e-9 Identity = 34/57 (59.65%), Postives = 40/57 (70.18%), Query Frame = 2 Query: 65 RVKTHEALSL*FQLPTVLTKNENNNLSFSQKENRIRELGQASTAKNYVEKNKRLLRD 235 R KT A++ QL V ++NE NLSFSQKE R R+ GQAS KNYVE+ KRLLRD Sbjct: 104 RQKTRYAIADGEQLMNVQSRNEKKNLSFSQKEKRKRDFGQASRGKNYVEEEKRLLRD 160
BLAST of HO664150 vs. TrEMBL
Match: A5B813_VITVI (Putative uncharacterized protein (Fragment) OS=Vitis vinifera GN=VITISV_023851 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.600e-9 Identity = 34/57 (59.65%), Postives = 40/57 (70.18%), Query Frame = 2 Query: 65 RVKTHEALSL*FQLPTVLTKNENNNLSFSQKENRIRELGQASTAKNYVEKNKRLLRD 235 R KT A++ QL V ++NE NLSFSQKE R R+ GQAS KNYVE+ KRLLRD Sbjct: 103 RQKTRYAIADGEQLMNVQSRNEKKNLSFSQKEKRKRDFGQASRGKNYVEEEKRLLRD 159
BLAST of HO664150 vs. TrEMBL
Match: B9H8B7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_559588 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.445e-7 Identity = 33/57 (57.89%), Postives = 36/57 (63.16%), Query Frame = 2 Query: 65 RVKTHEALSL*FQLPTVLTKNENNNLSFSQKENRIRELGQASTAKNYVEKNKRLLRD 235 R KT AL L V T E N+SF QKE R RELGQAS KNYVE+ KRLLR+ Sbjct: 101 RQKTRYALRDGEALMNVQTSKEKKNMSFQQKEKRKRELGQASRGKNYVEEEKRLLRE 157
BLAST of HO664150 vs. TAIR peptide
Match: AT4G04614.1 (| Symbols: | unknown protein; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr4:2327308-2327914 REVERSE LENGTH=176) HSP 1 Score: 52.373 bits (124), Expect = 2.537e-8 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 2 Query: 122 KNENNNLSFSQKENRIRELGQASTAKNYVEKNKRLLRD 235 +N+ NLSFSQKE + R+LGQAS KNYVE+ KR LR+ Sbjct: 130 RNDRKNLSFSQKEKKKRDLGQASRGKNYVEEEKRQLRE 167 HSP 2 Score: 21.1718 bits (43), Expect = 2.537e-8 Identity = 8/8 (100.00%), Postives = 8/8 (100.00%), Query Frame = 1 Query: 238 GVYSGFDS 261 GVYSGFDS Sbjct: 169 GVYSGFDS 176 The following BLAST results are available for this feature:
BLAST of HO664150 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of HO664150 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO664150 ID=HO664150; Name=HO664150; organism=Cicer arietinum; type=EST; length=322bpback to top |