DY475304
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475304 vs. TrEMBL
Match: A5B8T4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_024425 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.904e-7 Identity = 25/34 (73.53%), Postives = 30/34 (88.24%), Query Frame = 3 Query: 153 DEESKIGARIRVKXPLKVYHVPKVPEIDLAGMEG 254 +E KIGAR+RVK PLKV+HVP+VPE+DL GMEG Sbjct: 84 EEAGKIGARVRVKVPLKVFHVPRVPEVDLTGMEG 117
BLAST of DY475304 vs. TrEMBL
Match: B9RGK8_RICCO (Lipoic acid synthetase, putative OS=Ricinus communis GN=RCOM_1454610 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.487e-7 Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 3 Query: 90 VCARAAAPPRNSIMMIRCEEKDE----ESKIGARIRVKXPLKVYHVPKVPEIDLAGMEG 254 + A+P +S + E +E E+KIGAR++VK PLKVYHVP+VPE+DL G EG Sbjct: 77 ISCEVASPTSSSSTTLAQGEGEEPAVGENKIGARVKVKVPLKVYHVPRVPEVDLTGKEG 135
BLAST of DY475304 vs. TAIR peptide
Match: AT5G23440.1 (| Symbols: FTRA1 | ferredoxin/thioredoxin reductase subunit A (variable subunit) 1 | chr5:7903230-7903778 REVERSE LENGTH=182) HSP 1 Score: 53.5286 bits (127), Expect = 3.109e-8 Identity = 23/36 (63.89%), Postives = 30/36 (83.33%), Query Frame = 3 Query: 147 EKDEESKIGARIRVKXPLKVYHVPKVPEIDLAGMEG 254 E + ++KIG+R+RV PLKVYHV +VPE+DL GMEG Sbjct: 97 EAEAKAKIGSRVRVTAPLKVYHVNRVPEVDLEGMEG 132
BLAST of DY475304 vs. TAIR peptide
Match: AT5G08410.1 (| Symbols: FTRA2 | ferredoxin/thioredoxin reductase subunit A (variable subunit) 2 | chr5:2709974-2710528 REVERSE LENGTH=184) HSP 1 Score: 53.1434 bits (126), Expect = 4.061e-8 Identity = 23/37 (62.16%), Postives = 30/37 (81.08%), Query Frame = 3 Query: 144 EEKDEESKIGARIRVKXPLKVYHVPKVPEIDLAGMEG 254 E++ + KIGAR+RV PLKVYHV +VPE++L GMEG Sbjct: 98 EDEKAKEKIGARVRVTVPLKVYHVVRVPEVELMGMEG 134 The following BLAST results are available for this feature:
BLAST of DY475304 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of DY475304 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475304 ID=DY475304; Name=DY475304; organism=Cicer arietinum; type=EST; length=255bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|