HO063824
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO063824 vs. TrEMBL
Match: C6T5B3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.429e-7 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 3 Query: 42 TLLKDAAKAIQSMIQKNPDSLNFNVIALSKKS 137 TLL+DAAKAIQSMIQKNPDS NFNVIAL KKS Sbjct: 195 TLLRDAAKAIQSMIQKNPDSFNFNVIALCKKS 226
BLAST of HO063824 vs. TrEMBL
Match: C6T574_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.412e-7 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 3 Query: 42 TLLKDAAKAIQSMIQKNPDSLNFNVIALSKKSQ 140 TLL+DAAK IQSMIQKNP SLNFNVIA+SKKS+ Sbjct: 201 TLLRDAAKVIQSMIQKNPGSLNFNVIAISKKSK 233
BLAST of HO063824 vs. TAIR peptide
Match: AT4G17510.1 (| Symbols: UCH3 | ubiquitin C-terminal hydrolase 3 | chr4:9767114-9768648 REVERSE LENGTH=234) HSP 1 Score: 48.9062 bits (115), Expect = 8.860e-7 Identity = 22/32 (68.75%), Postives = 28/32 (87.50%), Query Frame = 3 Query: 42 TLLKDAAKAIQSMIQKNPDSLNFNVIALSKKS 137 TLLKDA K I+ MI+KNP SLNFN+IA+SK++ Sbjct: 203 TLLKDATKVIKKMIEKNPGSLNFNLIAISKRT 234 The following BLAST results are available for this feature:
BLAST of HO063824 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of HO063824 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO063824 ID=HO063824; Name=HO063824; organism=Cicer arietinum; type=EST; length=378bpback to top |