FE671222
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE671222 vs. SwissProt
Match: UBC2_WHEAT (Ubiquitin-conjugating enzyme E2 2 OS=Triticum aestivum GN=UBC2 PE=1 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 6.217e-12 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQF+EDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFTEDYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBC2_MEDSA (Ubiquitin-conjugating enzyme E2 2 OS=Medicago sativa GN=UBC2 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 8.119e-12 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBC2_ARATH (Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana GN=UBC2 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 8.119e-12 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBC1_ARATH (Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana GN=UBC1 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 8.119e-12 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBC3_ARATH (Ubiquitin-conjugating enzyme E2 3 OS=Arabidopsis thaliana GN=UBC3 PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 3.411e-10 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP+DTPWDGGTFKLTL F+EDYPNKPP V Sbjct: 41 FGPEDTPWDGGTFKLTLHFTEDYPNKPPIV 70
BLAST of FE671222 vs. SwissProt
Match: UBCD6_DROME (Ubiquitin-conjugating enzyme E2-17 kDa OS=Drosophila melanogaster GN=UbcD6 PE=2 SV=2) HSP 1 Score: 56.6102 bits (135), Expect = 1.213e-7 Identity = 22/30 (73.33%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP DTP++ GTFKLT++F+E+YPNKPPTV Sbjct: 41 FGPHDTPFEDGTFKLTIEFTEEYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBE2A_MOUSE (Ubiquitin-conjugating enzyme E2 A OS=Mus musculus GN=Ube2a PE=2 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 3.530e-7 Identity = 21/30 (70.00%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP+ TP++ GTFKLT++F+E+YPNKPPTV Sbjct: 41 FGPEGTPFEDGTFKLTIEFTEEYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBE2A_HUMAN (Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens GN=UBE2A PE=2 SV=2) HSP 1 Score: 55.0694 bits (131), Expect = 3.530e-7 Identity = 21/30 (70.00%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP+ TP++ GTFKLT++F+E+YPNKPPTV Sbjct: 41 FGPEGTPFEDGTFKLTIEFTEEYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBC1_CAEEL (Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans GN=ubc-1 PE=1 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 4.610e-7 Identity = 21/30 (70.00%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP +TP++ GTFKL+L+F+E+YPNKPPTV Sbjct: 41 FGPQETPFEDGTFKLSLEFTEEYPNKPPTV 70
BLAST of FE671222 vs. SwissProt
Match: UBE2B_RAT (Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus GN=Ube2b PE=2 SV=1) HSP 1 Score: 54.299 bits (129), Expect = 6.021e-7 Identity = 21/30 (70.00%), Postives = 27/30 (90.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP+ TP++ GTFKL ++FSE+YPNKPPTV Sbjct: 41 FGPEGTPFEDGTFKLVIEFSEEYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q9AVP0_TOBAC (Ubiquitin carrier protein OS=Nicotiana tabacum GN=Ntubc1 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q9AVN9_TOBAC (Ubiquitin carrier protein OS=Nicotiana tabacum GN=Ntubc2 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q5ZFS2_PLAMJ (Ubiquitin carrier protein OS=Plantago major GN=ubc2 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q5GMM2_CAPCH (Ubiquitin carrier protein OS=Capsicum chinense PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q2PYX5_SOLTU (Ubiquitin carrier protein OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: C0L7E1_ANNCH (Ubiquitin carrier protein OS=Annona cherimola GN=UCP PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 3.976e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q9M4R0_AVIMR (Ubiquitin carrier protein OS=Avicennia marina GN=UBC PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.858e-11 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQF+EDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFTEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q7XIC8_ORYSJ (Ubiquitin carrier protein OS=Oryza sativa subsp. japonica GN=P0039H02.138-1 PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.858e-11 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQF+EDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFTEDYPNKPPTV 70
BLAST of FE671222 vs. TrEMBL
Match: Q677E9_HYAOR (Ubiquitin carrier protein (Fragment) OS=Hyacinthus orientalis GN=UBC PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.858e-11 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQF+EDYPNKPPTV Sbjct: 37 FGPDDTPWDGGTFKLTLQFTEDYPNKPPTV 66
BLAST of FE671222 vs. TrEMBL
Match: Q5KQJ1_ORYSJ (Putative ubiquitin conjugating protein OS=Oryza sativa subsp. japonica GN=P0453H11.17 PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 8.858e-11 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKLTLQF+EDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLTLQFTEDYPNKPPTV 70
BLAST of FE671222 vs. TAIR peptide
Match: AT2G02760.1 (| Symbols: ATUBC2, UBC2 | ubiquiting-conjugating enzyme 2 | chr2:774271-775149 FORWARD LENGTH=152) HSP 1 Score: 70.4774 bits (171), Expect = 8.393e-13 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TAIR peptide
Match: AT1G14400.2 (| Symbols: UBC1, ATUBC1 | ubiquitin carrier protein 1 | chr1:4927294-4928136 REVERSE LENGTH=152) HSP 1 Score: 70.4774 bits (171), Expect = 8.393e-13 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TAIR peptide
Match: AT1G14400.1 (| Symbols: UBC1, ATUBC1 | ubiquitin carrier protein 1 | chr1:4927294-4928136 REVERSE LENGTH=152) HSP 1 Score: 70.4774 bits (171), Expect = 8.393e-13 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGPDDTPWDGGTFKL+LQFSEDYPNKPPTV Sbjct: 41 FGPDDTPWDGGTFKLSLQFSEDYPNKPPTV 70
BLAST of FE671222 vs. TAIR peptide
Match: AT5G62540.1 (| Symbols: UBC3 | ubiquitin-conjugating enzyme 3 | chr5:25104679-25105465 FORWARD LENGTH=150) HSP 1 Score: 65.0846 bits (157), Expect = 3.526e-11 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 1 Query: 535 FGPDDTPWDGGTFKLTLQFSEDYPNKPPTV 624 FGP+DTPWDGGTFKLTL F+EDYPNKPP V Sbjct: 41 FGPEDTPWDGGTFKLTLHFTEDYPNKPPIV 70 The following BLAST results are available for this feature:
BLAST of FE671222 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 10
BLAST of FE671222 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of FE671222 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE671222 ID=FE671222; Name=FE671222; organism=Cicer arietinum; type=EST; length=624bpback to top |