GR390714
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR390714 vs. TrEMBL
Match: D7TAR2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_10.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00010369001 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.350e-10 Identity = 35/63 (55.56%), Postives = 39/63 (61.90%), Query Frame = -2 Query: 6 KHFNFETLMKGTARTQAPTATNYDVGSTTWVDLRPAPLLSAMEVTCLSHGPS*SPIDSIQVSI 194 K N + ART+ P+ TNYDV S TW DLR PL SAMEVT L HG S S ID QVS+ Sbjct: 29 KRLNHHLIGAEVARTRTPSTTNYDVDSATWADLRAVPLPSAMEVTVLGHGSSRSAIDPAQVSM 91
BLAST of GR390714 vs. TrEMBL
Match: B9ICR6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_575649 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 3.206e-8 Identity = 33/46 (71.74%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 28 MGDQEGPWLRQVTSIALRRGAGLRSTQVVEPTS*FVAVGACVRAVP 165 MGD EGPW R VTSIA RRGAGLRS Q EPTS FVA GA A P Sbjct: 1 MGDPEGPWSRSVTSIAHRRGAGLRSPQEGEPTSKFVAEGAARVAAP 46 The following BLAST results are available for this feature:
BLAST of GR390714 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR390714 ID=GR390714; Name=GR390714; organism=Cicer arietinum; type=EST; length=516bpback to top |