FE672683
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672683 vs. TrEMBL
Match: B9T6D7_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0172840 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.098e-7 Identity = 32/52 (61.54%), Postives = 37/52 (71.15%), Query Frame = 3 Query: 240 FDPYXXXXXXXTRCFSQTQLVKSNGKHLFLVDTLALVRRLEGQGVPSKPAEA 395 FDP+ + C +Q VKSNG+ +FLVDTLALVRRLE QGVPSK AEA Sbjct: 37 FDPFASI----SPCRQISQFVKSNGRRVFLVDTLALVRRLEAQGVPSKQAEA 84
BLAST of FE672683 vs. TrEMBL
Match: D7SP35_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_23.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00018830001 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.873e-7 Identity = 38/78 (48.72%), Postives = 44/78 (56.41%), Query Frame = 3 Query: 171 AINRIKRF---GASRIAPSYSFQTAIFDPYXXXXXXXTRCFSQTQLVKSNGKHLFLVDTLALVRRLEGQGVPSKPAEA 395 A+N K F G S +F ++ P R FSQ VKSNG LFLVDTLALVR+LE QG+PSK AEA Sbjct: 68 ALNNFKAFSVEGKSNTIQFLAFLSSFSSPSGYCRRSDYRPFSQ--FVKSNGGRLFLVDTLALVRKLEAQGIPSKHAEA 143
BLAST of FE672683 vs. TAIR peptide
Match: AT3G51090.1 (| Symbols: | Protein of unknown function (DUF1640) | chr3:18978192-18979853 REVERSE LENGTH=298) HSP 1 Score: 56.225 bits (134), Expect = 6.280e-9 Identity = 27/35 (77.14%), Postives = 31/35 (88.57%), Query Frame = 3 Query: 291 TQLVKSNGKHLFLVDTLALVRRLEGQGVPSKPAEA 395 +QL+K+NGK LFLVDTLALVR LE QG+PSK AEA Sbjct: 110 SQLIKTNGKRLFLVDTLALVRSLEAQGLPSKQAEA 144
BLAST of FE672683 vs. TAIR peptide
Match: AT2G16460.1 (| Symbols: | Protein of unknown function (DUF1640) | chr2:7133704-7135483 REVERSE LENGTH=230) HSP 1 Score: 51.9878 bits (123), Expect = 1.184e-7 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3 Query: 291 TQLVKSNGKHLFLVDTLALVRRLEGQGVPSKPAEA 395 ++L K+NG+ FLVDTLALVR LE QGVPSK AEA Sbjct: 42 SELTKANGRRAFLVDTLALVRSLEAQGVPSKQAEA 76
BLAST of FE672683 vs. TAIR peptide
Match: AT2G16460.2 (| Symbols: | Protein of unknown function (DUF1640) | chr2:7133808-7135483 REVERSE LENGTH=173) HSP 1 Score: 51.9878 bits (123), Expect = 1.184e-7 Identity = 25/35 (71.43%), Postives = 29/35 (82.86%), Query Frame = 3 Query: 291 TQLVKSNGKHLFLVDTLALVRRLEGQGVPSKPAEA 395 ++L K+NG+ FLVDTLALVR LE QGVPSK AEA Sbjct: 42 SELTKANGRRAFLVDTLALVRSLEAQGVPSKQAEA 76 The following BLAST results are available for this feature:
BLAST of FE672683 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of FE672683 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672683 ID=FE672683; Name=FE672683; organism=Cicer arietinum; type=EST; length=397bpback to top |