GR394662
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR394662 vs. TrEMBL
Match: B8LLL2_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=4 SV=1) HSP 1 Score: 93.2041 bits (230), Expect = 1.393e-17 Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI+D EWI+EIPTVPI+YLAKP PR+RAW NQR KKTLLSLTL RL EM+ Sbjct: 1 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: A9U511_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_102363 PE=4 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 1.819e-17 Identity = 43/55 (78.18%), Postives = 48/55 (87.27%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI+D EWI+EIPTVPI+YLAKP PR+RAW NQR KKTLLSLTL RL EM+ Sbjct: 1 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWKNQRGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: C5WN92_SORBI (Putative uncharacterized protein Sb01g024170 OS=Sorghum bicolor GN=Sb01g024170 PE=4 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 1.179e-16 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI+D EWI+EIPTVP++Y AKP PR+RAW NQR KKTLLSLTL RL EM+ Sbjct: 1 MPRHLISDAHEWINEIPTVPVYYPAKPQPRERAWRNQRGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: C1NAN0_MICPS (Predicted protein OS=Micromonas pusilla CCMP1545 GN=MICPUCDRAFT_23907 PE=4 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 1.179e-16 Identity = 41/55 (74.55%), Postives = 47/55 (85.45%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI+D EWI+EIPTVP++Y AKP PR+RAW NQR KKTLLSLTL RL EM+ Sbjct: 1 MPRHLISDAHEWINEIPTVPVYYPAKPQPRERAWQNQRGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: A8NF35_BRUMA (Transcription factor, putative OS=Brugia malayi GN=Bm1_01210 PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 2.626e-16 Identity = 42/55 (76.36%), Postives = 45/55 (81.82%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI D EWI+EIPTVPI+YLAKP PR+RAW QR KKTLLSLTL RL E S Sbjct: 1 MPRHLIRDAHEWINEIPTVPIYYLAKPQPRERAWQTQRGKKTLLSLTLVRLCEES 55
BLAST of GR394662 vs. TrEMBL
Match: A7RYT6_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g223461 PE=4 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 2.626e-16 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTL 390 MPRHLI+D EWI+EIPTVPI+YLAKP PR+RAWHNQR KKTLLSLTL Sbjct: 1 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWHNQRGKKTLLSLTL 48
BLAST of GR394662 vs. TrEMBL
Match: B6SZV7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 88.5817 bits (218), Expect = 3.430e-16 Identity = 40/55 (72.73%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MPRHLI+D EWI+E PTVP++Y AKP PR+RAW NQR KKTLLSLTL RL EM+ Sbjct: 1 MPRHLISDAHEWINEFPTVPVYYPAKPQPRERAWRNQRGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: C5Y2D1_SORBI (Putative uncharacterized protein Sb05g016470 OS=Sorghum bicolor GN=Sb05g016470 PE=4 SV=1) HSP 1 Score: 88.1965 bits (217), Expect = 4.480e-16 Identity = 40/55 (72.73%), Postives = 46/55 (83.64%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTLARLSEMS 411 MP HLI+D EWI+EIPTVP++Y AKPHPR+RAW NQ KKTLLSLTL RL EM+ Sbjct: 1 MPHHLISDAHEWINEIPTVPVYYPAKPHPRERAWRNQWGKKTLLSLTLVRLCEMT 55
BLAST of GR394662 vs. TrEMBL
Match: B3SDD3_TRIAD (Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_33902 PE=4 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 2.223e-15 Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTL 390 MPRHLI+D EWI+EIPTVPI+YLAKP PR+RAW NQR KKTLLSLTL Sbjct: 1 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTL 48
BLAST of GR394662 vs. TrEMBL
Match: A7SPZ0_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g126575 PE=4 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 2.223e-15 Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 1 Query: 247 MPRHLINDTPEWISEIPTVPIHYLAKPHPRKRAWHNQRRKKTLLSLTL 390 MPRHLI+D EWI+EIPTVPI+YLAKP PR+RAW NQR KKTLLSLTL Sbjct: 1 MPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTL 48 The following BLAST results are available for this feature:
BLAST of GR394662 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR394662 ID=GR394662; Name=GR394662; organism=Cicer arietinum; type=EST; length=582bpback to top |