GR394837
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR394837 vs. TrEMBL
Match: A9U5J7_PHYPA (Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_39517 PE=4 SV=1) HSP 1 Score: 49.6766 bits (117), Expect = 7.844e-11 Identity = 23/35 (65.71%), Postives = 29/35 (82.86%), Query Frame = -2 Query: 57 LIELMLGHLRFLLTDVSLQAKSPPD*VFNLGRKSR 161 L+EL+LGHLR+LLTDV Q SPPD VF+L R++R Sbjct: 24 LVELILGHLRYLLTDVPPQPNSPPDNVFHLDRRTR 58 HSP 2 Score: 40.817 bits (94), Expect = 7.844e-11 Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = -3 Query: 149 VCILSENQNLMSFYPLVLHEISVSLSL 229 VCI +ENQN MSFYP V HEISV + L Sbjct: 1 VCIRTENQNQMSFYPFVPHEISVLVEL 27
BLAST of GR394837 vs. TrEMBL
Match: A8DW32_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g157013 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 22 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 80
BLAST of GR394837 vs. TrEMBL
Match: A7TBR5_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g224944 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77
BLAST of GR394837 vs. TrEMBL
Match: A7TBQ0_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g153878 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYXCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77
BLAST of GR394837 vs. TrEMBL
Match: A7TBM8_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g69016 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77
BLAST of GR394837 vs. TrEMBL
Match: A7TB26_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g224721 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 4 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 62
BLAST of GR394837 vs. TrEMBL
Match: A7T944_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g150890 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77
BLAST of GR394837 vs. TrEMBL
Match: A7T1X7_NEMVE (Predicted protein (Fragment) OS=Nematostella vectensis GN=v1g68210 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 22 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 80
BLAST of GR394837 vs. TrEMBL
Match: A7T0Z1_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g141022 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77
BLAST of GR394837 vs. TrEMBL
Match: A7SWM1_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g135518 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.273e-10 Identity = 36/60 (60.00%), Postives = 41/60 (68.33%), Query Frame = -3 Query: 149 WLPQASYSCGNFSGTIDLELPIWLKDS*ATLSAVCILSENQNLMSFYPLVLHEISVSLSL 328 WLPQASY CGNFS T L+L + K S VCI +ENQN +SFYP VLHEISV + L Sbjct: 19 WLPQASYPCGNFSDTSSLKL-LKTKGSIGHAFTVCIHTENQNQVSFYPFVLHEISVLIEL 77 The following BLAST results are available for this feature:
BLAST of GR394837 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR394837 ID=GR394837; Name=GR394837; organism=Cicer arietinum; type=EST; length=513bpback to top |