CD860231
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CD860231 vs. TrEMBL
Match: D7T4C6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_67.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032677001 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.196e-9 Identity = 28/33 (84.85%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 263 VLAFGYVLLHDPFSWRNILGILIALVGMVLYSY 295
BLAST of CD860231 vs. TrEMBL
Match: A5C3I8_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_021603 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.196e-9 Identity = 28/33 (84.85%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 249 VLAFGYVLLHDPFSWRNILGILIALVGMVLYSY 281
BLAST of CD860231 vs. TrEMBL
Match: D7SJJ9_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_4.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00024574001 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.562e-9 Identity = 27/33 (81.82%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LLHDPFSWRNI+GIL+A++GM+LYSY Sbjct: 263 VLAFGYVLLHDPFSWRNILGILIALIGMVLYSY 295
BLAST of CD860231 vs. TrEMBL
Match: B4G114_MAIZE (Integral membrane protein like OS=Zea mays PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.562e-9 Identity = 28/33 (84.85%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 264 VLAFGYVLLHDPFSWRNILGILIAVVGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: C0PHS3_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.040e-9 Identity = 27/33 (81.82%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LLHDPFSWRNI+GIL+A++GM+LYSY Sbjct: 264 VLAFGYVLLHDPFSWRNILGILIAVIGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: Q60DT9_ORYSJ (Os05g0168700 protein OS=Oryza sativa subsp. japonica GN=OSJNBa0086E02.16 PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.544e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VL FGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 264 VLTFGYVLLHDPFSWRNILGILIAVVGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: C5Z119_SORBI (Putative uncharacterized protein Sb09g005010 OS=Sorghum bicolor GN=Sb09g005010 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.544e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VL FGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 264 VLTFGYVLLHDPFSWRNILGILIAVVGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: C0PCW8_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.544e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VL FGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 264 VLTFGYVLLHDPFSWRNILGILIAVVGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: B8AYG9_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_18612 PE=4 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.544e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VL FGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 264 VLTFGYVLLHDPFSWRNILGILIAVVGMVLYSY 296
BLAST of CD860231 vs. TrEMBL
Match: B6T4J2_MAIZE (Integral membrane protein like OS=Zea mays PE=2 SV=1) HSP 1 Score: 64.3142 bits (155), Expect = 4.544e-9 Identity = 27/33 (81.82%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VL FGY LLHDPFSWRNI+GIL+A+VGM+LYSY Sbjct: 231 VLTFGYVLLHDPFSWRNILGILIAVVGMVLYSY 263
BLAST of CD860231 vs. SwissProt
Match: Y1689_ARATH (Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 7.174e-9 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL DPF WRNI+GIL+A++GM++YSY Sbjct: 263 VLAFGYVLLRDPFDWRNILGILVAVIGMVVYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT1G06890.3 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr1:2111585-2114038 REVERSE LENGTH=353) HSP 1 Score: 59.3066 bits (142), Expect = 5.696e-10 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL DPF WRNI+GIL+A++GM++YSY Sbjct: 263 VLAFGYVLLRDPFDWRNILGILVAVIGMVVYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT1G06890.2 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr1:2111728-2114038 REVERSE LENGTH=357) HSP 1 Score: 59.3066 bits (142), Expect = 5.696e-10 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL DPF WRNI+GIL+A++GM++YSY Sbjct: 263 VLAFGYVLLRDPFDWRNILGILVAVIGMVVYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT1G06890.1 (| Symbols: | nodulin MtN21 /EamA-like transporter family protein | chr1:2111728-2114038 REVERSE LENGTH=357) HSP 1 Score: 59.3066 bits (142), Expect = 5.696e-10 Identity = 24/33 (72.73%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL DPF WRNI+GIL+A++GM++YSY Sbjct: 263 VLAFGYVLLRDPFDWRNILGILVAVIGMVVYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT2G30460.2 (| Symbols: | Nucleotide/sugar transporter family protein | chr2:12976449-12978489 REVERSE LENGTH=353) HSP 1 Score: 58.151 bits (139), Expect = 1.269e-9 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL D FSWRNI+GIL+A++GM+LYSY Sbjct: 263 VLAFGYLLLKDAFSWRNILGILVAVIGMVLYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT2G30460.1 (| Symbols: | Nucleotide/sugar transporter family protein | chr2:12976449-12978489 REVERSE LENGTH=353) HSP 1 Score: 58.151 bits (139), Expect = 1.269e-9 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGY LL D FSWRNI+GIL+A++GM+LYSY Sbjct: 263 VLAFGYLLLKDAFSWRNILGILVAVIGMVLYSY 295
BLAST of CD860231 vs. TAIR peptide
Match: AT2G28315.1 (| Symbols: | Nucleotide/sugar transporter family protein | chr2:12088896-12090570 FORWARD LENGTH=342) HSP 1 Score: 58.151 bits (139), Expect = 1.269e-9 Identity = 26/33 (78.79%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 16 VLAFGYTLLHDPFSWRNIMGILLAMVGMILYSY 114 VLAFGYTLLHDPF+ RNI GIL+A++GM+LYSY Sbjct: 263 VLAFGYTLLHDPFTPRNIAGILIAVLGMLLYSY 295 The following BLAST results are available for this feature:
BLAST of CD860231 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 10
BLAST of CD860231 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of CD860231 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CD860231 ID=CD860231; Name=CD860231; organism=Pisum sativum; type=EST; length=114bpback to top |