AM161650
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM161650 vs. TrEMBL
Match: D7SXR5_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_91.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00037850001 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.430e-7 Identity = 29/52 (55.77%), Postives = 37/52 (71.15%), Query Frame = -2 Query: 3 SISSMDNNGSRRTSMSVSMYXXXXXXXRPRKSPPDLPSFLLDSRIVYLGLPI 158 S+S +++ G + SMSVSMY RPR +PPDLPS LLD+RI YLG+PI Sbjct: 135 SLSGVNDRGPSKYSMSVSMYRGGRGSGRPRTAPPDLPSLLLDARICYLGMPI 186
BLAST of AM161650 vs. TrEMBL
Match: C6TDX0_SOYBN (ATP-dependent Clp protease proteolytic subunit (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.099e-7 Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = -2 Query: 3 SISSMDNNGSRRTSMSVSMYXXXXXXXRPRKSPPDLPSFLLDSRIVYLGLPI 158 S+S M + + + SMSVSMY RP+ +PPDLPS LLD+RI YLG+PI Sbjct: 117 SLSGMGKSDASKYSMSVSMYRGGRGTGRPKTAPPDLPSLLLDARICYLGMPI 168
BLAST of AM161650 vs. SwissProt
Match: CLPR1_ARATH (ATP-dependent Clp protease proteolytic subunit-related protein 1, chloroplastic OS=Arabidopsis thaliana GN=CLPR1 PE=1 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 5.095e-7 Identity = 29/55 (52.73%), Postives = 35/55 (63.64%), Query Frame = -2 Query: 3 SISSMDNNGSRRTSMSVSMYXXXXXXXR---PRKSPPDLPSFLLDSRIVYLGLPI 158 S+S M+ +RR SMSV MY PR +PPDLPS LLD+RI YLG+PI Sbjct: 134 SMSGMNAADARRYSMSVQMYRGGGGGGGSERPRTAPPDLPSLLLDARICYLGMPI 188
BLAST of AM161650 vs. TAIR peptide
Match: AT1G49970.1 (| Symbols: CLPR1, NCLPP5, SVR2 | CLP protease proteolytic subunit 1 | chr1:18501936-18504462 REVERSE LENGTH=387) HSP 1 Score: 53.1434 bits (126), Expect = 3.965e-8 Identity = 29/55 (52.73%), Postives = 35/55 (63.64%), Query Frame = -2 Query: 3 SISSMDNNGSRRTSMSVSMYXXXXXXXR---PRKSPPDLPSFLLDSRIVYLGLPI 158 S+S M+ +RR SMSV MY PR +PPDLPS LLD+RI YLG+PI Sbjct: 134 SMSGMNAADARRYSMSVQMYRGGGGGGGSERPRTAPPDLPSLLLDARICYLGMPI 188 The following BLAST results are available for this feature:
BLAST of AM161650 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 2
BLAST of AM161650 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of AM161650 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM161650 ID=AM161650; Name=AM161650; organism=Pisum sativum; type=EST; length=240bpback to top |