BU964317
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BU964317 vs. TrEMBL
Match: Q2PER5_TRIPR (Putative early nodulin-like 2 predicted GPI-anchored protein (Fragment) OS=Trifolium pratense PE=2 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 6.238e-7 Identity = 24/39 (61.54%), Postives = 27/39 (69.23%), Query Frame = 3 Query: 6 KGSDSVLEVNKEAYDKCNXXNXXNKXXDGXTEXTLDRSG 122 KGSDS+LEV KE Y+KCN N K DG TE T D+SG Sbjct: 47 KGSDSLLEVKKEDYEKCNKTNPIKKFEDGETEFTFDKSG 85 HSP 2 Score: 24.6386 bits (52), Expect = 6.238e-7 Identity = 11/17 (64.71%), Postives = 12/17 (70.59%), Query Frame = 2 Query: 164 KKGXKXTLVXISPXGHT 214 +KG K TLV ISP HT Sbjct: 98 EKGQKLTLVVISPRKHT 114
BLAST of BU964317 vs. TrEMBL
Match: Q2PER5_TRIPR (Putative early nodulin-like 2 predicted GPI-anchored protein (Fragment) OS=Trifolium pratense PE=2 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 7.582e-7 Identity = 24/39 (61.54%), Postives = 27/39 (69.23%), Query Frame = 3 Query: 6 KGSDSVLEVNKEAYDKCNXXNXXNKXXDGXTEXTLDRSG 122 KGSDS+LEV KE Y+KCN N K DG TE T D+SG Sbjct: 47 KGSDSLLEVKKEDYEKCNKTNPIKKFEDGETEFTFDKSG 85 HSP 2 Score: 24.6386 bits (52), Expect = 7.582e-7 Identity = 11/17 (64.71%), Postives = 12/17 (70.59%), Query Frame = 2 Query: 164 KKGXKXTLVXISPXGHT 214 +KG K TLV ISP HT Sbjct: 98 EKGQKLTLVVISPRKHT 114
BLAST of BU964317 vs. Lotus protein
Match: chr3.CM0282.1000.r2.m (- phase: 0 ) HSP 1 Score: 52.7582 bits (125), Expect = 1.550e-8 Identity = 25/39 (64.10%), Postives = 26/39 (66.67%), Query Frame = 3 Query: 6 KGSDSVLEVNKEAYDKCNXXNXXNKXXDGXTEXTLDRSG 122 KGSDSVLEV KE +D CN N K DG TE T DRSG Sbjct: 62 KGSDSVLEVKKEDFDNCNKANPIKKFEDGDTEFTFDRSG 100 HSP 2 Score: 21.9422 bits (45), Expect = 1.550e-8 Identity = 10/18 (55.56%), Postives = 11/18 (61.11%), Query Frame = 2 Query: 164 KKGXKXTLVXISPXGHTP 217 +KG K LV ISP G P Sbjct: 113 EKGQKMILVVISPRGTQP 130
BLAST of BU964317 vs. Soybean peptides
Match: Glyma06g36590.1|PACid:16264382 () HSP 1 Score: 54.299 bits (129), Expect = 6.351e-8 Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 3 Query: 3 NKGSDSVLEVNKEAYDKCNXXNXXNKXXDGXTEXTLDRSG 122 NKGSDSVLEV KE YDKCN N K +G TE DRSG Sbjct: 61 NKGSDSVLEVKKEDYDKCNKTNPIKKFENGDTEFKFDRSG 100 The following BLAST results are available for this feature:
BLAST of BU964317 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of BU964317 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 1
BLAST of BU964317 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of BU964317 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Pisum sativum unigene v2
Date Performed: 2011-04-27
Analysis Name: InterProScan analysis for Pisum sativum unigene v1 Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BU964317 ID=BU964317; Name=BU964317; organism=Pisum sativum; type=EST; length=509bpback to top |