EX569800
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX569800 vs. Soybean peptides
Match: Glyma01g38500.1|PACid:16245612 () HSP 1 Score: 50.447 bits (119), Expect = 6.575e-7 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 2 Query: 2 LYNFDIERYNKLKDVCSP-TIPPMFDSSFALTVGNSSQH 115 L+NFDIE+YN+L+ CSP T+PP FD S AL NSS H Sbjct: 285 LHNFDIEKYNQLRAACSPTTMPPKFDPSIALPFDNSSIH 323
BLAST of EX569800 vs. Medicago proteins
Match: IMGA|Medtr5g019350.1 (Coiled-coil domain-containing protein 109A (AHRD V1 *-*- Q3UMR5); contains Interpro domain(s) IPR006769 Protein of unknown function DUF607 chr05_pseudomolecule_IMGAG_V3.5 7044657-7042658 E EGN_Mt100125 20100825) HSP 1 Score: 62.7734 bits (151), Expect = 7.709e-11 Identity = 28/38 (73.68%), Postives = 31/38 (81.58%), Query Frame = 2 Query: 2 LYNFDIERYNKLKDVCSPTIPPMFDSSFALTVGNSSQH 115 L+NFDIE+YNKL +VCSP PPMFDSS ALT GNS H Sbjct: 306 LHNFDIEKYNKLSNVCSPNAPPMFDSSTALTSGNSLHH 343 The following BLAST results are available for this feature:
BLAST of EX569800 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 1
BLAST of EX569800 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX569800 ID=EX569800; Name=EX569800; organism=Pisum sativum; type=EST; length=440bpback to top |