AM162066
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM162066 vs. Lotus protein
Match: chr1.CM0269.1260.r2.a (- phase: 0 ) HSP 1 Score: 53.5286 bits (127), Expect = 2.041e-8 Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 3 Query: 240 VLLPSSDLRLSFIGDDGKTERSFTLSSRSQ 329 VLLPSSDLRLSFIGDDGKTER FTL+S+ Q Sbjct: 160 VLLPSSDLRLSFIGDDGKTERLFTLTSKLQ 189
BLAST of AM162066 vs. Soybean peptides
Match: Glyma14g06730.1|PACid:16294614 () HSP 1 Score: 54.299 bits (129), Expect = 2.865e-8 Identity = 27/38 (71.05%), Postives = 32/38 (84.21%), Query Frame = 3 Query: 216 SERPHRAGVLLPSSDLRLSFIGDDGKTERSFTLSSRSQ 329 S R + VLLPSSDLRLSFIGDDG+TER FTL+++SQ Sbjct: 154 SNRGNLTLVLLPSSDLRLSFIGDDGRTERLFTLTNKSQ 191
BLAST of AM162066 vs. Soybean peptides
Match: Glyma02g42160.1|PACid:16249878 () HSP 1 Score: 53.5286 bits (127), Expect = 4.887e-8 Identity = 25/30 (83.33%), Postives = 29/30 (96.67%), Query Frame = 3 Query: 240 VLLPSSDLRLSFIGDDGKTERSFTLSSRSQ 329 VLLPSSDLRLSFIGDDG+TER FTL+++SQ Sbjct: 162 VLLPSSDLRLSFIGDDGRTERLFTLTNKSQ 191
BLAST of AM162066 vs. Medicago proteins
Match: IMGA|Medtr5g081880.1 (Unknown Protein (AHRD V1) chr05_pseudomolecule_IMGAG_V3.5 34109116-34101369 E EGN_Mt100125 20100825) HSP 1 Score: 56.9954 bits (136), Expect = 2.721e-9 Identity = 31/40 (77.50%), Postives = 34/40 (85.00%), Query Frame = 3 Query: 240 VLLPSSDLRLSFIGDDGKTERSFTLSSRSQMHLLLWLEGI 359 VLLPSSDLRLSFIGDDGKTER FTLSS SQ ++ +EGI Sbjct: 176 VLLPSSDLRLSFIGDDGKTERLFTLSSTSQCSAVV-VEGI 214 The following BLAST results are available for this feature:
BLAST of AM162066 vs. Lotus protein
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Lotus proteins) Total hits: 1
BLAST of AM162066 vs. Soybean peptides
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Soybean peptides) Total hits: 2
BLAST of AM162066 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM162066 ID=AM162066; Name=AM162066; organism=Pisum sativum; type=EST; length=360bpback to top |