EX568902
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EX568902 vs. TrEMBL
Match: Q84RS1_MEDSA (ZIK1 protein OS=Medicago sativa GN=zik1 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.449e-7 Identity = 26/32 (81.25%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 1 QVAVSDFLNEFSPEISLQLLNICNLQMPDSEV 96 ++AVSDFLNEFSPEISLQ+LN+CNLQMPD E+ Sbjct: 560 KLAVSDFLNEFSPEISLQVLNMCNLQMPDGEM 591
BLAST of EX568902 vs. TrEMBL
Match: Q84RS1_MEDSA (ZIK1 protein OS=Medicago sativa GN=zik1 PE=2 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 3.063e-7 Identity = 26/32 (81.25%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 1 QVAVSDFLNEFSPEISLQLLNICNLQMPDSEV 96 ++AVSDFLNEFSPEISLQ+LN+CNLQMPD E+ Sbjct: 560 KLAVSDFLNEFSPEISLQVLNMCNLQMPDGEM 591
BLAST of EX568902 vs. Medicago proteins
Match: IMGA|Medtr3g076650.1 (Serine/threonine-protein kinase WNK2 (AHRD V1 ***- Q8S8Y9); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase chr03_pseudomolecule_IMGAG_V3.5 24217164-24222691 E EGN_Mt100125 20100825) HSP 1 Score: 58.5362 bits (140), Expect = 1.428e-9 Identity = 26/32 (81.25%), Postives = 31/32 (96.88%), Query Frame = 1 Query: 1 QVAVSDFLNEFSPEISLQLLNICNLQMPDSEV 96 ++AVSDFLNEFSPEISLQ+LN+CNLQMPD E+ Sbjct: 560 KLAVSDFLNEFSPEISLQVLNMCNLQMPDGEM 591 The following BLAST results are available for this feature:
BLAST of EX568902 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 1
BLAST of EX568902 vs. TrEMBL
Analysis Date: 2011-04-27 (Homology Analysis: Pisum sativum unigene v2 vs Trembl) Total hits: 1
BLAST of EX568902 vs. Medicago proteins
Analysis Date: 2011-04-21 (Homology Analysis: Pisum sativum unigene v2 vs Medicago proteins) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EX568902 ID=EX568902; Name=EX568902; organism=Pisum sativum; type=EST; length=437bpback to top |