AM161929
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of AM161929 vs. TrEMBL
Match: C6TG15_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.733e-8 Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 EIVGHFVEITKDRIEGM+VANVRTIDPPQR Sbjct: 257 EIVGHFVEITKDRIEGMAVANVRTIDPPQR 286
BLAST of AM161929 vs. TrEMBL
Match: B9SBL4_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_0341900 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.467e-7 Identity = 27/30 (90.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 EIVGHFVEITKDRIEGM+ ANVRT+DPPQR Sbjct: 253 EIVGHFVEITKDRIEGMTGANVRTVDPPQR 282
BLAST of AM161929 vs. TrEMBL
Match: B9GXW5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_647415 PE=4 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.467e-7 Identity = 27/30 (90.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 EIVGHFVEITKDRIEGM+ ANVRT+DPPQR Sbjct: 240 EIVGHFVEITKDRIEGMTGANVRTVDPPQR 269
BLAST of AM161929 vs. TrEMBL
Match: D7SLP7_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_4.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00025513001 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.269e-7 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E+VGHFVEITKDRIEGM+ ANVRT+DPPQR Sbjct: 227 EMVGHFVEITKDRIEGMTGANVRTVDPPQR 256
BLAST of AM161929 vs. TrEMBL
Match: A5BJ27_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_041199 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.269e-7 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E+VGHFVEITKDRIEGM+ ANVRT+DPPQR Sbjct: 262 EMVGHFVEITKDRIEGMTGANVRTVDPPQR 291
BLAST of AM161929 vs. TrEMBL
Match: B9GLA6_POPTR (Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_177738 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.270e-7 Identity = 26/30 (86.67%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 EIVGHFVEITKDRIEGM+ AN+RTIDPP+R Sbjct: 288 EIVGHFVEITKDRIEGMTGANIRTIDPPRR 317
BLAST of AM161929 vs. TrEMBL
Match: D7LED4_ARALY (Predicted protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_333180 PE=4 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 5.576e-7 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E++GHFVEITKD+IEGM+ ANVRT+DPPQR Sbjct: 258 EVIGHFVEITKDKIEGMTGANVRTVDPPQR 287
BLAST of AM161929 vs. SwissProt
Match: PUR_ARATH (Transcription factor Pur-alpha 1 OS=Arabidopsis thaliana GN=PURA1 PE=1 SV=2) HSP 1 Score: 57.3806 bits (137), Expect = 2.719e-8 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E++GHFVEITKD+IEGM+ ANVRT+DPPQR Sbjct: 267 EVIGHFVEITKDKIEGMTGANVRTVDPPQR 296
BLAST of AM161929 vs. TAIR peptide
Match: AT2G32080.2 (| Symbols: PUR ALPHA-1 | purin-rich alpha 1 | chr2:13642716-13644036 REVERSE LENGTH=295) HSP 1 Score: 57.3806 bits (137), Expect = 2.094e-9 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E++GHFVEITKD+IEGM+ ANVRT+DPPQR Sbjct: 266 EVIGHFVEITKDKIEGMTGANVRTVDPPQR 295
BLAST of AM161929 vs. TAIR peptide
Match: AT2G32080.1 (| Symbols: PUR ALPHA-1 | purin-rich alpha 1 | chr2:13642716-13644036 REVERSE LENGTH=296) HSP 1 Score: 57.3806 bits (137), Expect = 2.094e-9 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 2 Query: 2 EIVGHFVEITKDRIEGMSVANVRTIDPPQR 91 E++GHFVEITKD+IEGM+ ANVRT+DPPQR Sbjct: 267 EVIGHFVEITKDKIEGMTGANVRTVDPPQR 296 The following BLAST results are available for this feature:
BLAST of AM161929 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Trembl) Total hits: 7
BLAST of AM161929 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Pisum sativum unigene v1 vs Swissprot) Total hits: 1
BLAST of AM161929 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Pisum sativum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >AM161929 ID=AM161929; Name=AM161929; organism=Pisum sativum; type=EST; length=357bpback to top |