Psat4g003880.1
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following five_prime_UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
Homology
BLAST of Psat4g003880.1 vs. DB:Swiss
Match: CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 63.5438 bits (153), Expect = 8.538e-13 Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 1 Query: 88 GGYHYRPLTYINE-YVVEIANFAVVEYCKESGTKVNLNKVIKGESSTVNEGINYRLTLSVVGEDSVSKIYESVVWESPLLPFRILISF 348 GG+ P++ + + VVEI FAV EY K S + + V+ GE+ V+ G NYRL ++ D VSK Y ++VW+ P + FR L SF Sbjct: 29 GGWS--PISNVTDPQVVEIGEFAVSEYNKRSESGLKFETVVSGETQVVS-GTNYRLKVAANDGDGVSKNYLAIVWDKPWMKFRNLTSF 113
BLAST of Psat4g003880.1 vs. DB:Swiss
Match: CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 5.985e-10 Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 1 Query: 82 APGGYHYRPLTYINEY-VVEIANFAVVEYCKESGTKVNLNKVIKGESSTVNEGINYRLTLSVVGEDSVSKIYESVVWESPLLPFRILISF 348 A GG+ RP+ +N V ++A FAV E+ K++ ++ V++G + V G NYRL ++ + +V YE+VVW+ P + FR L SF Sbjct: 28 AAGGW--RPIESLNSAEVQDVAQFAVSEHNKQANDELQYQSVVRGYTQVV-AGTNYRLVIAA-KDGAVVGNYEAVVWDKPWMHFRNLTSF 113 The following BLAST results are available for this feature:
BLAST of Psat4g003880.1 vs. DB:Swiss
Analysis Date: 2019-09-12 (BLAST: P. sativum Cameor genome v1a vs. Swissprot) Total hits: 2
InterPro
Analysis Name: InterProScan: P. sativum Cameor genome v1a
Date Performed: 2019-09-12
Sequences
The
following sequences are available for this feature:
mRNA sequence >Psat4g003880.1_Ps_Cameor_v1a ID=Psat4g003880.1_Ps_Cameor_v1a; Name=Psat4g003880.1; organism=Pisum sativum; type=mRNA; length=757bpback to top protein sequence of Psat4g003880.1_Ps_Cameor_v1a >Psat4g003880.1_Ps_Cameor_v1a ID=Psat4g003880.1_Ps_Cameor_v1a; Name=Psat4g003880.1_Ps_Cameor_v1a; organism=Pisum sativum; type=polypeptide; length=122bpback to top mRNA from alignment at chr4LG4:4275362..4276118- Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>Psat4g003880.1_Ps_Cameor_v1a ID=Psat4g003880.1_Ps_Cameor_v1a; Name=Psat4g003880.1; organism=Pisum sativum; type=mRNA; length=757bp; location=Sequence derived from: chr4LG4:4275362..4276118- (Pisum sativumback to top Coding sequence (CDS) from alignment at chr4LG4:4275362..4276118- >Psat4g003880.1_Ps_Cameor_v1a ID=Psat4g003880.1_Ps_Cameor_v1a; Name=Psat4g003880.1; organism=Pisum sativum; type=CDS; length=732bp; location=Sequence derived from: chr4LG4:4275362..4276118- (Pisum sativumback to top Annotated Terms
The
following terms have been associated with
this mRNA:
|