rna-KK1_004585
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-KK1_004585 vs. DB:Swiss
Match: NOIL_ELAOL (NOI-like protein OS=Elaeis oleifera OX=80265 PE=2 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 1.019e-8 Identity = 22/46 (47.83%), Postives = 29/46 (63.04%), Query Frame = 1 Query: 7 SHVPKFCNWDTDNIPYAVYFDNARNKR----PLINPNDPDENPEGF 132 +HVPKF NWD +NI Y YF+ + + NPNDP+ENP+ F Sbjct: 5 AHVPKFGNWDGENISYTTYFETVHRDKGDGSKIFNPNDPEENPQAF 50 The following BLAST results are available for this feature:
BLAST of rna-KK1_004585 vs. DB:Swiss
Analysis Date: 2019-10-17 (BLAST: C. cajan Asha genome v1.0 vs. Swissprot) Total hits: 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-KK1_004585_Cc_Asha_v1.0 ID=rna-KK1_004585_Cc_Asha_v1.0; Name=rna-KK1_004585; organism=Cajanus cajan; type=mRNA; length=171bpback to top protein sequence of rna-KK1_004585_Cc_Asha_v1.0 >rna-KK1_004585_Cc_Asha_v1.0 ID=rna-KK1_004585_Cc_Asha_v1.0; Name=rna-KK1_004585_Cc_Asha_v1.0; organism=Cajanus cajan; type=polypeptide; length=56bpback to top mRNA from alignment at Chr_11-CM003613.1:48390386..48390556+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-KK1_004585_Cc_Asha_v1.0 ID=rna-KK1_004585_Cc_Asha_v1.0; Name=rna-KK1_004585; organism=Cajanus cajan; type=mRNA; length=171bp; location=Sequence derived from: Chr_11-CM003613.1:48390386..48390556+ (Cajanus cajanback to top Coding sequence (CDS) from alignment at Chr_11-CM003613.1:48390386..48390556+ >rna-KK1_004585_Cc_Asha_v1.0 ID=rna-KK1_004585_Cc_Asha_v1.0; Name=rna-KK1_004585; organism=Cajanus cajan; type=CDS; length=342bp; location=Sequence derived from: Chr_11-CM003613.1:48390386..48390556+ (Cajanus cajanback to top |