rna-KK1_036698
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-KK1_036698 vs. DB:Swiss
Match: POLR1_ARATH (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 63.1586 bits (152), Expect = 3.215e-12 Identity = 30/74 (40.54%), Postives = 47/74 (63.51%), Query Frame = 1 Query: 1 MLACKPADTPIEMNHSLAIYPDQIEMDKHRYQRLVGKLIYLSHTRPGIAYSVSIVSRFVHSPSEEHMTTIYRIL 222 M+ KP TP+ + L++Y D Y+ +VG L YL+ TRP I+Y+V+ +S+F+H P+EEH+ + RIL Sbjct: 1215 MITAKPVTTPMAPSPKLSLYSGTKLTDPTEYRGIVGSLQYLAFTRPDISYAVNRLSQFMHMPTEEHLQALKRIL 1288
BLAST of rna-KK1_036698 vs. DB:Swiss
Match: POLR2_ARATH (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 1.911e-9 Identity = 25/74 (33.78%), Postives = 45/74 (60.81%), Query Frame = 1 Query: 1 MLACKPADTPIEMNHSLAIYPDQIEMDKHRYQRLVGKLIYLSHTRPGIAYSVSIVSRFVHSPSEEHMTTIYRIL 222 ML KP TP+ + L ++ D Y+ +VG L YL+ TRP ++Y+V+ +S+++H P+++H + R+L Sbjct: 1198 MLTAKPVATPMATSPKLTLHSGTKLPDPTEYRGIVGSLQYLAFTRPDLSYAVNRLSQYMHMPTDDHWNALKRVL 1271
BLAST of rna-KK1_036698 vs. DB:Swiss
Match: M810_ARATH (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 50.8322 bits (120), Expect = 6.221e-8 Identity = 30/78 (38.46%), Postives = 47/78 (60.26%), Query Frame = 1 Query: 1 MLACKPADTPI--EMNHSL--AIYPDQIEMDKHRYQRLVGKLIYLSHTRPGIAYSVSIVSRFVHSPSEEHMTTIYRIL 222 ML CKP TP+ ++N S+ A YPD + ++ +VG L YL+ TRP I+Y+V+IV + +H P+ + R+L Sbjct: 71 MLDCKPMSTPLPLKLNSSVSTAKYPDPSD-----FRSIVGALQYLTLTRPDISYAVNIVCQRMHEPTLADFDLLKRVL 143 The following BLAST results are available for this feature:
BLAST of rna-KK1_036698 vs. DB:Swiss
Analysis Date: 2019-10-17 (BLAST: C. cajan Asha genome v1.0 vs. Swissprot) Total hits: 3
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-KK1_036698_Cc_Asha_v1.0 ID=rna-KK1_036698_Cc_Asha_v1.0; Name=rna-KK1_036698; organism=Cajanus cajan; type=mRNA; length=231bpback to top protein sequence of rna-KK1_036698_Cc_Asha_v1.0 >rna-KK1_036698_Cc_Asha_v1.0 ID=rna-KK1_036698_Cc_Asha_v1.0; Name=rna-KK1_036698_Cc_Asha_v1.0; organism=Cajanus cajan; type=polypeptide; length=76bpback to top mRNA from alignment at Scaffold128880-KQ483745.1:227115..227345+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-KK1_036698_Cc_Asha_v1.0 ID=rna-KK1_036698_Cc_Asha_v1.0; Name=rna-KK1_036698; organism=Cajanus cajan; type=mRNA; length=231bp; location=Sequence derived from: Scaffold128880-KQ483745.1:227115..227345+ (Cajanus cajanback to top Coding sequence (CDS) from alignment at Scaffold128880-KQ483745.1:227115..227345+ >rna-KK1_036698_Cc_Asha_v1.0 ID=rna-KK1_036698_Cc_Asha_v1.0; Name=rna-KK1_036698; organism=Cajanus cajan; type=CDS; length=462bp; location=Sequence derived from: Scaffold128880-KQ483745.1:227115..227345+ (Cajanus cajanback to top |