rna-TanjilR_19673
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-TanjilR_19673 vs. DB:Swiss
Match: CG160_ARATH (Protein CONSERVED ONLY IN THE GREEN LINEAGE 160, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CGL160 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.247e-13 Identity = 38/57 (66.67%), Postives = 45/57 (78.95%), Query Frame = 1 Query: 109 KWSTGVAPGDYGGXXXXXXXXXKLRKYWGGDDEDPLASDDFMWNKDFMGRFKKLIED 279 KWSTGVAPG+YGGPP TT KLRKYWGG+ EDP+ S D +WN+DFM + KKL +D Sbjct: 39 KWSTGVAPGEYGGPPTTT----KLRKYWGGEKEDPITSTDLIWNRDFMDQMKKLFDD 91 HSP 2 Score: 74.7146 bits (182), Expect = 1.512e-12 Identity = 37/48 (77.08%), Postives = 40/48 (83.33%), Query Frame = 2 Query: 4370 LTMVFG--CRILVPEYGFMHLELIPMLVGFFTYKIATFSQAIENAITV 4507 L M+F ILVPEYGFMHLELIPMLVGFFTYKIATF QAIE AI++ Sbjct: 287 LVMIFNRWNAILVPEYGFMHLELIPMLVGFFTYKIATFFQAIEEAISI 334 The following BLAST results are available for this feature:
BLAST of rna-TanjilR_19673 vs. DB:Swiss
Analysis Date: 2020-01-28 (BLAST: L. angustifolius cv. Tanjil genome v1.0 vs. Swissprot) Total hits: 1 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan: L. angustifolius cv. Tanjil genome v1.0
Date Performed: 2020-01-28 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-TanjilR_19673_La_Tanjil_v1.0 ID=rna-TanjilR_19673_La_Tanjil_v1.0; Name=rna-TanjilR_19673; organism=Lupinus angustifolius; type=mRNA; length=4525bpback to top protein sequence of rna-TanjilR_19673_La_Tanjil_v1.0 >rna-TanjilR_19673_La_Tanjil_v1.0 ID=rna-TanjilR_19673_La_Tanjil_v1.0; Name=rna-TanjilR_19673_La_Tanjil_v1.0; organism=Lupinus angustifolius; type=polypeptide; length=336bpback to top mRNA from alignment at Chr_LG13-CM007373.1:4122046..4126570+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-TanjilR_19673_La_Tanjil_v1.0 ID=rna-TanjilR_19673_La_Tanjil_v1.0; Name=rna-TanjilR_19673; organism=Lupinus angustifolius; type=mRNA; length=4525bp; location=Sequence derived from: Chr_LG13-CM007373.1:4122046..4126570+ (Lupinus angustifoliusback to top Coding sequence (CDS) from alignment at Chr_LG13-CM007373.1:4122046..4126570+ >rna-TanjilR_19673_La_Tanjil_v1.0 ID=rna-TanjilR_19673_La_Tanjil_v1.0; Name=rna-TanjilR_19673; organism=Lupinus angustifolius; type=CDS; length=1011bp; location=Sequence derived from: Chr_LG13-CM007373.1:4122046..4126570+ (Lupinus angustifoliusback to top |