Cicer_arietinum_v1_Contig1549
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig1549 vs. TrEMBL
Match: C6SVN4_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 3.025e-15 Identity = 41/75 (54.67%), Postives = 46/75 (61.33%), Query Frame = -1 Query: 433 SEDCLINNXXXXXXXXXXSHVARMLYEGSQSQTGKTANNNAASVKCPTNQGYRSCLPTATGGTPNYRCATYTRGC 657 +EDCLI N SHVARMLY+ SQS +GKT N N +V CP QGYRSCLP+ GG P C YTR C Sbjct: 30 TEDCLIGNKDLESEFYFGSHVARMLYDVSQSVSGKTGNKNNKAVNCPNKQGYRSCLPSKNGGGPKQSCGDYTRVC 104
BLAST of Cicer_arietinum_v1_Contig1549 vs. TrEMBL
Match: C6T4V1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 3.345e-14 Identity = 40/75 (53.33%), Postives = 48/75 (64.00%), Query Frame = -1 Query: 433 SEDCLINNXXXXXXXXXXSHVARMLYEGSQSQTGKTANNNAASVKCPTNQGYRSCLPTATGGTPNYRCATYTRGC 657 +EDCLI + HVARMLY+ SQS +G+T N+N A V CP + GYRSCLP+ GG PN RC YTR C Sbjct: 31 TEDCLIGDNFESEFSFGS-HVARMLYDVSQSVSGQTGNSNNAVVNCPQSNGYRSCLPSQNGGGPNQRCGDYTRTC 104
BLAST of Cicer_arietinum_v1_Contig1549 vs. TrEMBL
Match: C6T279_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 4.830e-13 Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = -1 Query: 433 SEDCLINNXXXXXXXXXXSHVARMLYEGSQSQTGKTANNNAASVKCPTNQGYRSCLPTATGGTPNYRCATYTRGC 657 +EDCLI + HVARMLY+ SQS +G+T N+N A+V CP + GYRSCL + GG PN C YTR C Sbjct: 30 TEDCLIGHSLESEFSFGS-HVARMLYDVSQSVSGQTGNSNNAAVNCPESNGYRSCLSSQNGGGPNQNCGDYTRTC 103 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig1549 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig1549 ID=Cicer_arietinum_v1_Contig1549; Name=Cicer_arietinum_v1_Contig1549; organism=Cicer arietinum; type=contig; length=660bpback to top |