Cicer_arietinum_v1_Contig2205
Contig Overview
Alignments
The following features are aligned
Unigenes
This contig is part of the following unigenes:
Analyses
This contig is derived from or has results from the following analyses
Relationships
The following EST feature(s) are a part of this contig:
Homology
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: B1QFQ5_CLOBO (Putative uncharacterized protein OS=Clostridium botulinum NCTC 2916 GN=CBN_A0029 PE=4 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 1.558e-17 Identity = 42/55 (76.36%), Postives = 46/55 (83.64%), Query Frame = -3 Query: 4 MYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 168 MYS+ DTWG+PCEFPHSEI GSQ IC YP+L AAYRVLLRL +PRHSP AL LT Sbjct: 1 MYSVHDTWGYPCEFPHSEIPGSQPICGYPRLIAAYRVLLRLLVPRHSPCALCSLT 55
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: C4G4Q1_ABIDE (Putative uncharacterized protein OS=Abiotrophia defectiva ATCC 49176 GN=GCWU000182_02230 PE=4 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.082e-10 Identity = 39/72 (54.17%), Postives = 48/72 (66.67%), Query Frame = 3 Query: 6 SRYKGRMVNALASGAEEGRDKLRKALGRRK*PVIQRSPNEETHMGNPMYP*VNT*LMEGKLRELKHLST*RK 221 S YKGR +ALA GAEEGRDKLRKA GR K P+I+R PN ET + P + ++ + ELKHLS+ RK Sbjct: 43 SSYKGRRADALAPGAEEGRDKLRKAAGRSKYPLIRRYPNGETRQKELLSPYDESIVIRREPGELKHLSSRRK 114
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A5KRJ3_9FIRM (Putative uncharacterized protein OS=Ruminococcus torques ATCC 27756 GN=RUMTOR_02886 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.480e-9 Identity = 37/70 (52.86%), Postives = 41/70 (58.57%), Query Frame = -3 Query: 1 YLDVSVP*VYLP*AMYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILTR 210 YLDVSV V + T FPHSEISGS IC PKLFAAY V RL +PRH PYAL +T+ Sbjct: 28 YLDVSVHRVPFLTLWIGVRITEVCSVRFPHSEISGSMGICPSPKLFAAYHVFHRLLVPRHPPYALISITK 97
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A5KR92_9FIRM (Putative uncharacterized protein OS=Ruminococcus torques ATCC 27756 GN=RUMTOR_02784 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 3.480e-9 Identity = 37/70 (52.86%), Postives = 41/70 (58.57%), Query Frame = -3 Query: 1 YLDVSVP*VYLP*AMYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILTR 210 YLDVSV V + T FPHSEISGS IC PKLFAAY V RL +PRH PYAL +T+ Sbjct: 63 YLDVSVHRVPFLTLWIGVRITEVCSVRFPHSEISGSMGICPSPKLFAAYHVFHRLLVPRHPPYALISITK 132
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A6BL10_9FIRM (Putative uncharacterized protein OS=Dorea longicatena DSM 13814 GN=DORLON_03026 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.727e-8 Identity = 37/69 (53.62%), Postives = 42/69 (60.87%), Query Frame = -3 Query: 4 YLDVSVP*VYLP*AMYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 210 YLDVSV V L + FPHSEISGS+ IC+ PKLFAAY V RL +PRH PYAL +T Sbjct: 63 YLDVSVHRVPLLTLCIGVRILEVCSSGFPHSEISGSKDICSSPKLFAAYHVFHRLLVPRHPPYALSSMT 131
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A6BL09_9FIRM (Putative uncharacterized protein OS=Dorea longicatena DSM 13814 GN=DORLON_03023 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.727e-8 Identity = 37/69 (53.62%), Postives = 42/69 (60.87%), Query Frame = -3 Query: 4 YLDVSVP*VYLP*AMYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 210 YLDVSV V L + FPHSEISGS+ IC+ PKLFAAY V RL +PRH PYAL +T Sbjct: 63 YLDVSVHRVPLLTLCIGVRILEVCSSGFPHSEISGSKDICSSPKLFAAYHVFHRLLVPRHPPYALSSMT 131
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A6BKY6_9FIRM (Putative uncharacterized protein OS=Dorea longicatena DSM 13814 GN=DORLON_02997 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.727e-8 Identity = 37/69 (53.62%), Postives = 42/69 (60.87%), Query Frame = -3 Query: 4 YLDVSVP*VYLP*AMYSLMDTWGFPCEFPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 210 YLDVSV V L + FPHSEISGS+ IC+ PKLFAAY V RL +PRH PYAL +T Sbjct: 112 YLDVSVHRVPLLTLCIGVRILEVCSSGFPHSEISGSKDICSSPKLFAAYHVFHRLLVPRHPPYALSSMT 180
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: B5CMS1_9FIRM (Putative uncharacterized protein OS=Ruminococcus lactaris ATCC 29176 GN=RUMLAC_00756 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.946e-8 Identity = 29/42 (69.05%), Postives = 31/42 (73.81%), Query Frame = -3 Query: 4 FPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 129 FPHSEISGS IC PKLFAAY V RL +PRH PYAL +T Sbjct: 65 FPHSEISGSMGICPSPKLFAAYHVFHRLLVPRHPPYALISIT 106
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A6P1U5_9BACE (Putative uncharacterized protein OS=Bacteroides capillosus ATCC 29799 GN=BACCAP_04470 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.946e-8 Identity = 31/42 (73.81%), Postives = 33/42 (78.57%), Query Frame = -3 Query: 4 FPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 129 FPHSEISGS+A+CA PKL AA VL RL MPRHSP AL LT Sbjct: 9 FPHSEISGSKAVCASPKLIAACHVLHRLLMPRHSPCALISLT 50
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Match: A6BKX9_9FIRM (Putative uncharacterized protein OS=Dorea longicatena DSM 13814 GN=DORLON_02988 PE=4 SV=1) HSP 1 Score: 61.6178 bits (148), Expect = 2.946e-8 Identity = 29/42 (69.05%), Postives = 33/42 (78.57%), Query Frame = -3 Query: 4 FPHSEISGSQAICAYPKLFAAYRVLLRLPMPRHSPYALYILT 129 FPHSEISGS+ IC+ PKLFAAY V RL +PRH PYAL +T Sbjct: 26 FPHSEISGSKDICSSPKLFAAYHVFHRLLVPRHPPYALSSMT 67 The following BLAST results are available for this feature:
BLAST of Cicer_arietinum_v1_Contig2205 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
Sequences
The
following sequences are available for this feature:
contig sequence >Cicer_arietinum_v1_Contig2205 ID=Cicer_arietinum_v1_Contig2205; Name=Cicer_arietinum_v1_Contig2205; organism=Cicer arietinum; type=contig; length=221bpback to top |