HO065085
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO065085 vs. SwissProt
Match: GSTX6_SOYBN (Probable glutathione S-transferase OS=Glycine max GN=HSP26-A PE=2 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 1.216e-16 Identity = 39/53 (73.58%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GLQLF +EK P LYKWS EFLNHP V E +PPRDP+FAYFKA YESL SK Sbjct: 173 IAGLQLFTSEKFPILYKWSQEFLNHPFVHEVLPPRDPLFAYFKARYESLSASK 225
BLAST of HO065085 vs. TrEMBL
Match: Q43678_9FABA (Auxin-induced protein (Fragment) OS=Vigna radiata PE=2 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 5.048e-16 Identity = 37/53 (69.81%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GL+L +EK PNLY+WS EFLNHPIVKE++PPRDP+FA+FK YE LF SK Sbjct: 178 IAGLELLTSEKFPNLYRWSQEFLNHPIVKESLPPRDPVFAFFKGRYEGLFSSK 230
BLAST of HO065085 vs. TrEMBL
Match: Q84T17_PHAAT (Glutathione S-transferase OS=Phaseolus acutifolius PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 1.125e-15 Identity = 36/53 (67.92%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GL+L +EK PNLYKWS EF++HPIVKE++PPRDP+F +FK YESLF SK Sbjct: 173 IAGLELLTSEKFPNLYKWSQEFVSHPIVKESLPPRDPVFGFFKGRYESLFASK 225
BLAST of HO065085 vs. TrEMBL
Match: C6T5M2_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 85.1149 bits (209), Expect = 2.505e-15 Identity = 39/53 (73.58%), Postives = 42/53 (79.25%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GLQLF +EK P LYKWS EFLNHP V E +PPRDP+FAYFKA YESL SK Sbjct: 173 IAGLQLFTSEKFPILYKWSQEFLNHPFVHEVLPPRDPLFAYFKARYESLSASK 225
BLAST of HO065085 vs. TrEMBL
Match: Q9FQF0_SOYBN (Glutathione S-transferase GST 8 OS=Glycine max PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 7.289e-15 Identity = 36/53 (67.92%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GL+LF +EK P L+ WS EFLNHPIVKE++PPRDP+F++FK YESLF SK Sbjct: 173 IAGLELFTSEKFPKLHNWSQEFLNHPIVKESLPPRDPVFSFFKGLYESLFGSK 225
BLAST of HO065085 vs. TrEMBL
Match: C6SZT9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 7.289e-15 Identity = 35/53 (66.04%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GL+L ++EK P LYKWS EF+NHPIVKE++PPRDP+FA+FK YESL S+ Sbjct: 173 IAGLELLSSEKFPKLYKWSQEFVNHPIVKESLPPRDPVFAFFKGRYESLSASR 225
BLAST of HO065085 vs. TrEMBL
Match: C6SYQ0_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 83.5741 bits (205), Expect = 7.289e-15 Identity = 36/53 (67.92%), Postives = 44/53 (83.02%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GL+LF +EK P L+ WS EFLNHPIVKE++PPRDP+F++FK YESLF SK Sbjct: 130 IAGLELFTSEKFPKLHNWSQEFLNHPIVKESLPPRDPVFSFFKGLYESLFGSK 182
BLAST of HO065085 vs. TrEMBL
Match: C6TIU4_SOYBN (Putative uncharacterized protein (Fragment) OS=Glycine max PE=2 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.053e-13 Identity = 34/50 (68.00%), Postives = 42/50 (84.00%), Query Frame = 2 Query: 11 LQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 L+LF +EK P L+ WS EFLNHPIVKE++PPRDP+F++FK YESLF SK Sbjct: 1 LELFTSEKFPKLHNWSQEFLNHPIVKESLPPRDPVFSFFKGLYESLFGSK 50
BLAST of HO065085 vs. TrEMBL
Match: Q9FQF2_SOYBN (Glutathione S-transferase GST 6 OS=Glycine max PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 3.063e-13 Identity = 32/53 (60.38%), Postives = 43/53 (81.13%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 + GLQLF +EK P L+KWS E +NHP+VK+ +PPR+P+FA+FK+ YESL SK Sbjct: 173 VAGLQLFTSEKFPKLFKWSQELINHPVVKDVLPPREPLFAFFKSLYESLSASK 225
BLAST of HO065085 vs. TrEMBL
Match: C6T2G7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 4.000e-13 Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVSK 160 I GLQ+F +EK P LYKWS EF++HP+VKE +PPRDP+F +A YESL SK Sbjct: 173 IAGLQIFTSEKFPKLYKWSQEFMSHPVVKEVLPPRDPLFCLLQARYESLSASK 225
BLAST of HO065085 vs. TrEMBL
Match: C6T2G1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 4.000e-13 Identity = 35/52 (67.31%), Postives = 40/52 (76.92%), Query Frame = 2 Query: 2 ITGLQLFNAEKCPNLYKWSHEFLNHPIVKENMPPRDPIFAYFKAHYESLFVS 157 I GLQLF +EK P LYKWS E LNHP V+E +PPRDP+F +FKA YESL S Sbjct: 173 IAGLQLFTSEKFPILYKWSQESLNHPFVQEVLPPRDPLFTFFKARYESLSAS 224 The following BLAST results are available for this feature:
BLAST of HO065085 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of HO065085 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO065085 ID=HO065085; Name=HO065085; organism=Cicer arietinum; type=EST; length=328bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|