GR397562
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR397562 vs. TrEMBL
Match: C6T3T3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.593e-9 Identity = 30/35 (85.71%), Postives = 34/35 (97.14%), Query Frame = -2 Query: 101 NEGSIKRRNEKKRVKQRYAFILAEKKKRKAQMQEA 205 NEGS+KRRNEKKR++QR AFILAEKKKRKAQ+QEA Sbjct: 103 NEGSVKRRNEKKRMRQRRAFILAEKKKRKAQLQEA 137
BLAST of GR397562 vs. TrEMBL
Match: C6T3P1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.593e-9 Identity = 30/35 (85.71%), Postives = 34/35 (97.14%), Query Frame = -2 Query: 101 NEGSIKRRNEKKRVKQRYAFILAEKKKRKAQMQEA 205 NEGS+KRRNEKKR++QR AFILAEKKKRKAQ+QEA Sbjct: 103 NEGSVKRRNEKKRMRQRRAFILAEKKKRKAQLQEA 137
BLAST of GR397562 vs. TrEMBL
Match: C6SVP3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.691e-8 Identity = 29/35 (82.86%), Postives = 34/35 (97.14%), Query Frame = -2 Query: 101 NEGSIKRRNEKKRVKQRYAFILAEKKKRKAQMQEA 205 NEGS+KRRNEKKR++QR AFILAE+KKRKAQ+QEA Sbjct: 103 NEGSVKRRNEKKRMRQRRAFILAERKKRKAQLQEA 137
BLAST of GR397562 vs. TrEMBL
Match: B9HFB2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_820063 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.096e-7 Identity = 28/35 (80.00%), Postives = 32/35 (91.43%), Query Frame = -2 Query: 101 NEGSIKRRNEKKRVKQRYAFILAEKKKRKAQMQEA 205 N GS+KRRNEKKR++QR FILAEKKKRKAQ+QEA Sbjct: 111 NVGSVKRRNEKKRIRQRKEFILAEKKKRKAQLQEA 145
BLAST of GR397562 vs. TAIR peptide
Match: AT3G51010.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: mitochondrion, plastid; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; Has 24 Blast hits to 24 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 24; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:18946880-18948048 REVERSE LENGTH=188) HSP 1 Score: 54.6842 bits (130), Expect = 1.405e-8 Identity = 26/35 (74.29%), Postives = 31/35 (88.57%), Query Frame = -2 Query: 101 NEGSIKRRNEKKRVKQRYAFILAEKKKRKAQMQEA 205 NEGS+KRRN KKR+ QR AFIL+EKKKR+A +QEA Sbjct: 112 NEGSVKRRNAKKRIGQRRAFILSEKKKRQALVQEA 146 The following BLAST results are available for this feature:
BLAST of GR397562 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of GR397562 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR397562 ID=GR397562; Name=GR397562; organism=Cicer arietinum; type=EST; length=206bpback to top |