FE672523
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE672523 vs. SwissProt
Match: H2B_GOSHI (Histone H2B OS=Gossypium hirsutum GN=HIS2B PE=2 SV=3) HSP 1 Score: 58.9214 bits (141), Expect = 2.947e-9 Identity = 28/33 (84.85%), Postives = 29/33 (87.88%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G AA GDKKKKR KKSVETYKIYIF VL+QVHP Sbjct: 41 GGAAAGDKKKKRVKKSVETYKIYIFKVLKQVHP 73 HSP 2 Score: 21.557 bits (44), Expect = 2.947e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 74 DIGISSKAMG 83
BLAST of FE672523 vs. SwissProt
Match: H2B2_MEDTR (Probable histone H2B.2 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 57.7658 bits (138), Expect = 6.430e-9 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G +A G+KKKKR+KKSVETYKIYIF VL+QVHP Sbjct: 42 GGSAAGEKKKKRSKKSVETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 6.430e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. SwissProt
Match: H2B1_MEDTR (Probable histone H2B.1 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 57.7658 bits (138), Expect = 6.430e-9 Identity = 26/33 (78.79%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G +A G+KKKKR+KKSVETYKIYIF VL+QVHP Sbjct: 42 GGSAAGEKKKKRSKKSVETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 6.430e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. SwissProt
Match: H2B3_SOLLC (Histone H2B.3 (Fragment) OS=Solanum lycopersicum GN=H2B-3 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 1.086e-8 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 AA GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 33 AAAGDKKKKRSKKAVETYKIYIFKVLKQVHP 63 HSP 2 Score: 21.557 bits (44), Expect = 1.086e-8 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 64 DIGISSKAMG 73
BLAST of FE672523 vs. SwissProt
Match: H2B10_ARATH (Histone H2B.10 OS=Arabidopsis thaliana GN=At5g22880 PE=1 SV=3) HSP 1 Score: 55.4546 bits (132), Expect = 3.063e-8 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 41 AGAGDKKKKRSKKNVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 3.063e-8 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. SwissProt
Match: H2B1_ARATH (Histone H2B.1 OS=Arabidopsis thaliana GN=At1g07790 PE=1 SV=3) HSP 1 Score: 53.9138 bits (128), Expect = 8.645e-8 Identity = 24/28 (85.71%), Postives = 27/28 (96.43%), Query Frame = 3 Query: 198 GDKKKKRNKKSVETYKIYIFGVLRQVHP 281 GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 47 GDKKKKRSKKNVETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 8.645e-8 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. SwissProt
Match: H2B6_ARATH (Histone H2B.6 OS=Arabidopsis thaliana GN=H2B PE=1 SV=3) HSP 1 Score: 53.5286 bits (127), Expect = 1.120e-7 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 45 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 76 HSP 2 Score: 21.557 bits (44), Expect = 1.120e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 77 DIGISSKAMG 86
BLAST of FE672523 vs. SwissProt
Match: H2B11_ARATH (Histone H2B.11 OS=Arabidopsis thaliana GN=At5g59910 PE=1 SV=5) HSP 1 Score: 53.5286 bits (127), Expect = 1.120e-7 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 45 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 76 HSP 2 Score: 21.557 bits (44), Expect = 1.120e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 77 DIGISSKAMG 86
BLAST of FE672523 vs. SwissProt
Match: H2B7_ARATH (Histone H2B.7 OS=Arabidopsis thaliana GN=At3g46030 PE=1 SV=3) HSP 1 Score: 53.5286 bits (127), Expect = 1.122e-7 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 40 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 1.122e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. SwissProt
Match: H2B3_MEDTR (Probable histone H2B.3 OS=Medicago truncatula PE=3 SV=3) HSP 1 Score: 53.5286 bits (127), Expect = 1.458e-7 Identity = 24/34 (70.59%), Postives = 27/34 (79.41%), Query Frame = 3 Query: 180 VGSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + + DKKKKR KKSVETYKIYIF VL+QVHP Sbjct: 31 ISKEGSSDKKKKRTKKSVETYKIYIFKVLKQVHP 64 HSP 2 Score: 21.1718 bits (43), Expect = 1.458e-7 Identity = 8/10 (80.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIG+SS+AMG Sbjct: 65 DIGVSSKAMG 74
BLAST of FE672523 vs. TrEMBL
Match: B9T4D7_RICCO (Histone H2B OS=Ricinus communis GN=RCOM_0390320 PE=3 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 2.787e-8 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G+AA GDKKKKR KKS+ETYKIYIF VL+QVHP Sbjct: 42 GAAAAGDKKKKRTKKSIETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 2.787e-8 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. TrEMBL
Match: A5BCC0_VITVI (Histone H2B OS=Vitis vinifera GN=VITISV_032908 PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 2.230e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 AA GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 48 AAAGDKKKKRSKKNVETYKIYIFKVLKQVHP 78 HSP 2 Score: 21.557 bits (44), Expect = 2.230e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 79 DIGISSKAMG 88
BLAST of FE672523 vs. TrEMBL
Match: B3SGL7_MEDTR (Histone H2B OS=Medicago truncatula PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 2.242e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A++ DKKKKRNKKSVETYKIYIF VL+QVHP Sbjct: 33 ASSADKKKKRNKKSVETYKIYIFKVLKQVHP 63 HSP 2 Score: 21.557 bits (44), Expect = 2.242e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 64 DIGISSKAMG 73
BLAST of FE672523 vs. TrEMBL
Match: B7FHC9_MEDTR (Histone H2B OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.896e-7 Identity = 25/33 (75.76%), Postives = 30/33 (90.91%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G +A G+KKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 42 GGSAAGEKKKKRSKKNVETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 2.896e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. TrEMBL
Match: A2IBL2_NICBE (Histone H2B OS=Nicotiana benthamiana GN=H2b PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.897e-7 Identity = 27/31 (87.10%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 AA GDKKKKR KKSVETYKIYIF VL+QVHP Sbjct: 43 AAAGDKKKKRLKKSVETYKIYIFKVLKQVHP 73 HSP 2 Score: 21.557 bits (44), Expect = 2.897e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 74 DIGISSKAMG 83
BLAST of FE672523 vs. TrEMBL
Match: C6SWE9_SOYBN (Histone H2B OS=Glycine max PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 2.908e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 AA+G+KKKKR KKSVETYKIYIF VL+QVHP Sbjct: 33 AASGEKKKKRTKKSVETYKIYIFKVLKQVHP 63 HSP 2 Score: 21.557 bits (44), Expect = 2.908e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 64 DIGISSKAMG 73
BLAST of FE672523 vs. TrEMBL
Match: B9GV78_POPTR (Histone H2B OS=Populus trichocarpa GN=HTB903 PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 3.755e-7 Identity = 26/33 (78.79%), Postives = 28/33 (84.85%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G+A GDKKKKR KKS ETYKIYIF VL+QVHP Sbjct: 42 GAAVAGDKKKKRVKKSTETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 3.755e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. TrEMBL
Match: A9PJR3_9ROSI (Histone H2B OS=Populus trichocarpa x Populus deltoides PE=2 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 3.755e-7 Identity = 26/33 (78.79%), Postives = 28/33 (84.85%), Query Frame = 3 Query: 183 GSAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 G+A GDKKKKR KKS ETYKIYIF VL+QVHP Sbjct: 42 GAAVAGDKKKKRVKKSTETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 3.755e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. TrEMBL
Match: Q1H5F7_ARATH (Histone H2B OS=Arabidopsis thaliana PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 6.322e-7 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 41 AGAGDKKKKRSKKNVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 6.322e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. TrEMBL
Match: Q0WS75_ARATH (Histone H2B OS=Arabidopsis thaliana GN=At5g22880 PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 6.322e-7 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 41 AGAGDKKKKRSKKNVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 6.322e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. TAIR peptide
Match: AT5G22880.1 (| Symbols: H2B, HTB2 | histone B2 | chr5:7652130-7652567 REVERSE LENGTH=145) HSP 1 Score: 55.4546 bits (132), Expect = 2.421e-9 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 41 AGAGDKKKKRSKKNVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 2.421e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. TAIR peptide
Match: AT1G07790.1 (| Symbols: HTB1 | Histone superfamily protein | chr1:2413049-2413495 FORWARD LENGTH=148) HSP 1 Score: 53.9138 bits (128), Expect = 6.833e-9 Identity = 24/28 (85.71%), Postives = 27/28 (96.43%), Query Frame = 3 Query: 198 GDKKKKRNKKSVETYKIYIFGVLRQVHP 281 GDKKKKR+KK+VETYKIYIF VL+QVHP Sbjct: 47 GDKKKKRSKKNVETYKIYIFKVLKQVHP 74 HSP 2 Score: 21.557 bits (44), Expect = 6.833e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 75 DIGISSKAMG 84
BLAST of FE672523 vs. TAIR peptide
Match: AT5G59910.1 (| Symbols: HTB4 | Histone superfamily protein | chr5:24127206-24127658 FORWARD LENGTH=150) HSP 1 Score: 53.5286 bits (127), Expect = 8.852e-9 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 45 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 76 HSP 2 Score: 21.557 bits (44), Expect = 8.852e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 77 DIGISSKAMG 86
BLAST of FE672523 vs. TAIR peptide
Match: AT3G45980.1 (| Symbols: H2B, HTB9 | Histone superfamily protein | chr3:16897492-16897944 REVERSE LENGTH=150) HSP 1 Score: 53.5286 bits (127), Expect = 8.852e-9 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 45 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 76 HSP 2 Score: 21.557 bits (44), Expect = 8.852e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 77 DIGISSKAMG 86
BLAST of FE672523 vs. TAIR peptide
Match: AT3G46030.1 (| Symbols: HTB11 | Histone superfamily protein | chr3:16913614-16914051 REVERSE LENGTH=145) HSP 1 Score: 53.5286 bits (127), Expect = 8.868e-9 Identity = 25/32 (78.12%), Postives = 27/32 (84.38%), Query Frame = 3 Query: 186 SAATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 + A GDKKKK KKSVETYKIYIF VL+QVHP Sbjct: 40 AGAGGDKKKKMKKKSVETYKIYIFKVLKQVHP 71 HSP 2 Score: 21.557 bits (44), Expect = 8.868e-9 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 72 DIGISSKAMG 81
BLAST of FE672523 vs. TAIR peptide
Match: AT2G37470.1 (| Symbols: | Histone superfamily protein | chr2:15736832-15737248 FORWARD LENGTH=138) HSP 1 Score: 50.8322 bits (120), Expect = 1.979e-7 Identity = 23/31 (74.19%), Postives = 27/31 (87.10%), Query Frame = 3 Query: 189 AATGDKKKKRNKKSVETYKIYIFGVLRQVHP 281 A +KKKK++KKSVETYKIYIF VL+QVHP Sbjct: 35 AGGSEKKKKKSKKSVETYKIYIFKVLKQVHP 65
BLAST of FE672523 vs. TAIR peptide
Match: AT2G28720.1 (| Symbols: | Histone superfamily protein | chr2:12327043-12327498 FORWARD LENGTH=151) HSP 1 Score: 48.9062 bits (115), Expect = 1.984e-7 Identity = 25/33 (75.76%), Postives = 27/33 (81.82%), Query Frame = 3 Query: 189 AATG--DKKKKRNKKSVETYKIYIFGVLRQVHP 281 A TG +KKKKR KKS ETYKIYIF VL+QVHP Sbjct: 45 AVTGGVEKKKKRVKKSTETYKIYIFKVLKQVHP 77 HSP 2 Score: 21.557 bits (44), Expect = 1.984e-7 Identity = 9/10 (90.00%), Postives = 10/10 (100.00%), Query Frame = 1 Query: 283 DIGISSEAMG 312 DIGISS+AMG Sbjct: 78 DIGISSKAMG 87
BLAST of FE672523 vs. TAIR peptide
Match: AT3G53650.1 (| Symbols: | Histone superfamily protein | chr3:19889358-19889774 FORWARD LENGTH=138) HSP 1 Score: 48.521 bits (114), Expect = 9.821e-7 Identity = 20/27 (74.07%), Postives = 26/27 (96.30%), Query Frame = 3 Query: 201 DKKKKRNKKSVETYKIYIFGVLRQVHP 281 +KKKK++KK++ETYKIYIF VL+QVHP Sbjct: 38 EKKKKKSKKNIETYKIYIFKVLKQVHP 64 The following BLAST results are available for this feature:
BLAST of FE672523 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 10
BLAST of FE672523 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
BLAST of FE672523 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 8
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE672523 ID=FE672523; Name=FE672523; organism=Cicer arietinum; type=EST; length=312bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|