GR407638
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR407638 vs. TrEMBL
Match: B7FM67_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.188e-7 Identity = 28/31 (90.32%), Postives = 29/31 (93.55%), Query Frame = -1 Query: 176 VFAAVPGKTVNQCKKKFAMMKENFRNKKTAV 268 V AAVPGKTV QCKKKFA+MKENFRNKKTAV Sbjct: 218 VAAAVPGKTVIQCKKKFAVMKENFRNKKTAV 248
BLAST of GR407638 vs. TrEMBL
Match: B9SS17_RICCO (Zuotin, putative OS=Ricinus communis GN=RCOM_0519910 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.163e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = -1 Query: 176 VFAAVPGKTVNQCKKKFAMMKENFRNKKTAV 268 V AAVPGKTVNQCKKKF ++KENFRNKK+AV Sbjct: 664 VAAAVPGKTVNQCKKKFTLLKENFRNKKSAV 694
BLAST of GR407638 vs. TrEMBL
Match: D7T9T8_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_11.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00012187001 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.101e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = -1 Query: 176 VFAAVPGKTVNQCKKKFAMMKENFRNKKTAV 268 V AAVPGKTVNQCKKKFA++KE+FRNKK AV Sbjct: 501 VAAAVPGKTVNQCKKKFALLKEHFRNKKNAV 531
BLAST of GR407638 vs. TrEMBL
Match: A5C384_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_040643 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.101e-7 Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = -1 Query: 176 VFAAVPGKTVNQCKKKFAMMKENFRNKKTAV 268 V AAVPGKTVNQCKKKFA++KE+FRNKK AV Sbjct: 615 VAAAVPGKTVNQCKKKFALLKEHFRNKKNAV 645
BLAST of GR407638 vs. TAIR peptide
Match: AT3G11450.1 (| Symbols: | DnaJ domain ;Myb-like DNA-binding domain | chr3:3605459-3607402 REVERSE LENGTH=647) HSP 1 Score: 50.8322 bits (120), Expect = 1.987e-7 Identity = 24/31 (77.42%), Postives = 26/31 (83.87%), Query Frame = -1 Query: 176 VFAAVPGKTVNQCKKKFAMMKENFRNKKTAV 268 V AAVPGKT+NQCKKKFA +KE RNKKT V Sbjct: 617 VAAAVPGKTMNQCKKKFAELKEIIRNKKTGV 647 The following BLAST results are available for this feature:
BLAST of GR407638 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 4
BLAST of GR407638 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR407638 ID=GR407638; Name=GR407638; organism=Cicer arietinum; type=EST; length=268bpback to top |