HO063079
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO063079 vs. TrEMBL
Match: C6TNT6_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 1.985e-12 Identity = 46/82 (56.10%), Postives = 56/82 (68.29%), Query Frame = -3 Query: 73 RGE-DTGVWEKLKERKETSEGIVVLRGKLFLEK*VVMEKRTK--KNRFQYDAHSYALNFNSGAQSEDEEYLPPSFSSRFFAP 309 +GE ++ V EKL++ KE SE I + K F+ K K+ K +NRFQYD HSYA NFNSGAQSEDE +P SFSSRF AP Sbjct: 54 KGEGESWVVEKLRKAKEVSEVIAGPKWKTFIRKISGYGKKVKQQRNRFQYDEHSYAFNFNSGAQSEDEG-MPHSFSSRFAAP 134
BLAST of HO063079 vs. TrEMBL
Match: C6T1C1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.340e-11 Identity = 44/82 (53.66%), Postives = 54/82 (65.85%), Query Frame = -3 Query: 73 RGE-DTGVWEKLKERKETSEGIVVLRGKLFLEK*VVMEKRTK--KNRFQYDAHSYALNFNSGAQSEDEEYLPPSFSSRFFAP 309 +GE ++ V KL++ KE SE I + K F+ K K+ K +NRFQYD HSYALNFNS AQ EDE +P SFSSRF AP Sbjct: 53 KGEGESWVVNKLRKAKEVSEVIAGPKWKTFIRKISGYGKKVKYQRNRFQYDEHSYALNFNSEAQREDEG-MPHSFSSRFAAP 133 The following BLAST results are available for this feature:
BLAST of HO063079 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO063079 ID=HO063079; Name=HO063079; organism=Cicer arietinum; type=EST; length=329bpback to top |