HO065951
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO065951 vs. SwissProt
Match: GSTXC_TOBAC (Probable glutathione S-transferase parC OS=Nicotiana tabacum GN=PARC PE=2 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 5.090e-7 Identity = 24/37 (64.86%), Postives = 26/37 (70.27%), Query Frame = -3 Query: 212 TLGTFIVEKECPKFLSWAKRCXXIESVXKSLPXQEKV 322 T G F E ECPKF++WAKRC ESV KSLP Q KV Sbjct: 171 TFGNFSTEAECPKFVAWAKRCMQRESVAKSLPDQPKV 207
BLAST of HO065951 vs. SwissProt
Match: GSTX4_TOBAC (Probable glutathione S-transferase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 53.1434 bits (126), Expect = 5.090e-7 Identity = 24/37 (64.86%), Postives = 26/37 (70.27%), Query Frame = -3 Query: 212 TLGTFIVEKECPKFLSWAKRCXXIESVXKSLPXQEKV 322 T G F E ECPKF++WAKRC ESV KSLP Q KV Sbjct: 171 TFGNFSTEAECPKFVAWAKRCMQRESVAKSLPDQPKV 207
BLAST of HO065951 vs. TrEMBL
Match: B7FMC4_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 4.234e-7 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = -3 Query: 212 TLGTFIVEKECPKFLSWAKRCXXIESVXKSLPXQEKV 322 T G VEKECPKF++WAKRC +ES+ KSLP Q+KV Sbjct: 169 TFGNINVEKECPKFIAWAKRCMQVESISKSLPDQDKV 205
BLAST of HO065951 vs. TrEMBL
Match: B7FHD0_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.432e-7 Identity = 23/37 (62.16%), Postives = 29/37 (78.38%), Query Frame = -3 Query: 212 TLGTFIVEKECPKFLSWAKRCXXIESVXKSLPXQEKV 322 T G VEKECPKF++WAKRC +ES+ KS+P Q+KV Sbjct: 169 TFGNINVEKECPKFIAWAKRCMQVESISKSVPDQDKV 205
BLAST of HO065951 vs. TAIR peptide
Match: AT1G17180.1 (| Symbols: ATGSTU25, GSTU25 | glutathione S-transferase TAU 25 | chr1:5872208-5872958 FORWARD LENGTH=221) HSP 1 Score: 49.2914 bits (116), Expect = 6.070e-7 Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = -3 Query: 212 GTFIVEKECPKFLSWAKRCXXIESVXKSLPXQEKV 316 G+F +E ECPK ++W KRC ESV KSLP EK+ Sbjct: 171 GSFSIEAECPKLIAWGKRCVERESVAKSLPDSEKI 205 The following BLAST results are available for this feature:
BLAST of HO065951 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 2
BLAST of HO065951 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of HO065951 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO065951 ID=HO065951; Name=HO065951; organism=Cicer arietinum; type=EST; length=363bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|