GO660536

EST Overview
NameGO660536
Unique NameGO660536
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length181
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of GO660536 vs. TrEMBL
Match: Q2QQD3_ORYSJ (Expressed protein OS=Oryza sativa subsp. japonica GN=LOC_Os12g31440 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.342e-11
Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = -2
Query:   31 TRP*ALEDITALFYDEERNEIYTGNRHGLVHVWSN 135
            T P ALED+TALFYDE+RNEIYTGNRHGLVHVWSN
Sbjct:  454 TIPEALEDVTALFYDEDRNEIYTGNRHGLVHVWSN 488          
BLAST of GO660536 vs. TrEMBL
Match: A3CHJ9_ORYSJ (Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_36171 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.342e-11
Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = -2
Query:   31 TRP*ALEDITALFYDEERNEIYTGNRHGLVHVWSN 135
            T P ALED+TALFYDE+RNEIYTGNRHGLVHVWSN
Sbjct:  377 TIPEALEDVTALFYDEDRNEIYTGNRHGLVHVWSN 411          
BLAST of GO660536 vs. TrEMBL
Match: Q9M387_ARATH (Putative uncharacterized protein F24B22.150 OS=Arabidopsis thaliana GN=F24B22.150 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  424 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 454          
BLAST of GO660536 vs. TrEMBL
Match: Q9C5G8_ARATH (AT3g54190/F24B22_150 OS=Arabidopsis thaliana GN=At3g54190 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467          
BLAST of GO660536 vs. TrEMBL
Match: D7T4U0_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_67.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032872001 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  434 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 464          
BLAST of GO660536 vs. TrEMBL
Match: D7LUR4_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_906825 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467          
BLAST of GO660536 vs. TrEMBL
Match: C6TAN3_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  209 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 239          
BLAST of GO660536 vs. TrEMBL
Match: B9S4I5_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0690530 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  252 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 282          
BLAST of GO660536 vs. TrEMBL
Match: B9S1V3_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1323040 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  440 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 470          
BLAST of GO660536 vs. TrEMBL
Match: B9N1R5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_784330 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.090e-10
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  444 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 474          
BLAST of GO660536 vs. TAIR peptide
Match: AT3G54190.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr3:20061759-20063880 REVERSE LENGTH=467)

HSP 1 Score: 69.707 bits (169), Expect = 4.146e-13
Identity = 31/31 (100.00%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGLVHVWSN
Sbjct:  437 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 467          
BLAST of GO660536 vs. TAIR peptide
Match: AT2G38630.1 (| Symbols: | Transducin/WD40 repeat-like superfamily protein | chr2:16154283-16156302 REVERSE LENGTH=467)

HSP 1 Score: 68.5514 bits (166), Expect = 9.235e-13
Identity = 30/31 (96.77%), Postives = 31/31 (100.00%), Query Frame = -2
Query:   31 ALEDITALFYDEERNEIYTGNRHGLVHVWSN 123
            ALEDITALFYDEERNEIYTGNRHGL+HVWSN
Sbjct:  437 ALEDITALFYDEERNEIYTGNRHGLLHVWSN 467          
The following BLAST results are available for this feature:
BLAST of GO660536 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
Q2QQD3_ORYSJ8.342e-1188.57Expressed protein OS=Oryza sativa subsp. japonica ... [more]
A3CHJ9_ORYSJ8.342e-1188.57Putative uncharacterized protein OS=Oryza sativa s... [more]
Q9M387_ARATH1.090e-10100.00Putative uncharacterized protein F24B22.150 OS=Ara... [more]
Q9C5G8_ARATH1.090e-10100.00AT3g54190/F24B22_150 OS=Arabidopsis thaliana GN=At... [more]
D7T4U0_VITVI1.090e-10100.00Whole genome shotgun sequence of line PN40024, sca... [more]
D7LUR4_ARALY1.090e-10100.00Putative uncharacterized protein OS=Arabidopsis ly... [more]
C6TAN3_SOYBN1.090e-10100.00Putative uncharacterized protein OS=Glycine max PE... [more]
B9S4I5_RICCO1.090e-10100.00Putative uncharacterized protein OS=Ricinus commun... [more]
B9S1V3_RICCO1.090e-10100.00Putative uncharacterized protein OS=Ricinus commun... [more]
B9N1R5_POPTR1.090e-10100.00Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
back to top
BLAST of GO660536 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 2
Match NameE-valueIdentityDescription
AT3G54190.14.146e-13100.00| Symbols: | Transducin/WD40 repeat-like superfam... [more]
AT2G38630.19.235e-1396.77| Symbols: | Transducin/WD40 repeat-like superfam... [more]
back to top
Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>GO660536 ID=GO660536|Name=GO660536|organism=Cicer arietinum|type=EST|length=181bp
TGACTGCGTACCAATTCAAGCAAAAAATCAATTGGACCACACATGAACAA
GGCCGTGTCTGTTTCCTGTGTATATCTCATTGCGTTCTTCGTCGTAGAAA
AGAGCGGTTATGTCTTCCAAAGCTTACGGTCTAGTTCATGTCTGGTCTAA
CTGATGTATTGTGTTACTCAGGACTCATCAA
back to top