GR915701
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR915701 vs. SwissProt
Match: SR54C_ARATH (Signal recognition particle 54 kDa protein, chloroplastic OS=Arabidopsis thaliana GN=FFC PE=1 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.890e-7 Identity = 25/32 (78.12%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNL 123 VA+MGS++RV+GMIPGM KV+PA IREAEKNL Sbjct: 415 VAKMGSMTRVLGMIPGMGKVSPAQIREAEKNL 446
BLAST of GR915701 vs. TrEMBL
Match: O82532_PEA (Signal recognition particle 54 kDa subunit (Fragment) OS=Pisum sativum GN=Ffc PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.105e-7 Identity = 29/34 (85.29%), Postives = 32/34 (94.12%), Query Frame = 1 Query: 25 TVAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 TVA+MGSVSRV+GMIPGM KVTPA IREAEKNL+ Sbjct: 373 TVAKMGSVSRVLGMIPGMAKVTPAQIREAEKNLQ 406
BLAST of GR915701 vs. TrEMBL
Match: Q53QG1_ORYSJ (Os11g0153700 protein OS=Oryza sativa subsp. japonica GN=Os11g0153700 PE=2 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.884e-7 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +AQMGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 414 IAQMGSFSRIIGMIPGMNKVTPAQIREAEKNLK 446
BLAST of GR915701 vs. TrEMBL
Match: Q53LU9_ORYSJ (Signal recognition particle protein, putative OS=Oryza sativa subsp. japonica GN=LOC_Os11g05560 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.884e-7 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +AQMGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 837 IAQMGSFSRIIGMIPGMNKVTPAQIREAEKNLK 869
BLAST of GR915701 vs. TrEMBL
Match: B8BJ56_ORYSI (Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_35151 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.884e-7 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +AQMGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 414 IAQMGSFSRIIGMIPGMNKVTPAQIREAEKNLK 446
BLAST of GR915701 vs. TrEMBL
Match: A2Q2E3_MEDTR (Signal peptide binding (SRP54) M-domain OS=Medicago truncatula GN=MtrDRAFT_AC150442g31v2 PE=4 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 1.884e-7 Identity = 29/33 (87.88%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 VAQMGSVSRVIGMIPGM KVTPA IREAE+NL+ Sbjct: 62 VAQMGSVSRVIGMIPGMAKVTPAQIREAERNLE 94
BLAST of GR915701 vs. TrEMBL
Match: C5YS38_SORBI (Putative uncharacterized protein Sb08g003410 OS=Sorghum bicolor GN=Sb08g003410 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 3.214e-7 Identity = 28/33 (84.85%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +AQMGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 416 IAQMGSFSRLIGMIPGMNKVTPAQIREAEKNLK 448
BLAST of GR915701 vs. TrEMBL
Match: C4J3Y8_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.352e-7 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +A+MGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 208 IAKMGSFSRLIGMIPGMNKVTPAQIREAEKNLK 240
BLAST of GR915701 vs. TrEMBL
Match: B4FZB8_MAIZE (Putative uncharacterized protein OS=Zea mays PE=2 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.352e-7 Identity = 27/33 (81.82%), Postives = 30/33 (90.91%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNLK 126 +A+MGS SR+IGMIPGM KVTPA IREAEKNLK Sbjct: 413 IAKMGSFSRLIGMIPGMNKVTPAQIREAEKNLK 445
BLAST of GR915701 vs. TAIR peptide
Match: AT5G03940.1 (| Symbols: FFC, 54CP, CPSRP54, SRP54CP | chloroplast signal recognition particle 54 kDa subunit | chr5:1060265-1063257 REVERSE LENGTH=564) HSP 1 Score: 53.5286 bits (127), Expect = 3.094e-8 Identity = 25/32 (78.12%), Postives = 30/32 (93.75%), Query Frame = 1 Query: 28 VAQMGSVSRVIGMIPGMXKVTPAXIREAEKNL 123 VA+MGS++RV+GMIPGM KV+PA IREAEKNL Sbjct: 415 VAKMGSMTRVLGMIPGMGKVSPAQIREAEKNL 446 The following BLAST results are available for this feature:
BLAST of GR915701 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of GR915701 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 8
BLAST of GR915701 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR915701 ID=GR915701; Name=GR915701; organism=Cicer arietinum; type=EST; length=128bpback to top |