HO066763
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO066763 vs. SwissProt
Match: BGAL7_ORYSJ (Beta-galactosidase 7 OS=Oryza sativa subsp. japonica GN=Os05g0428100 PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 2.970e-7 Identity = 29/67 (43.28%), Postives = 37/67 (55.22%), Query Frame = -2 Query: 177 GRYX-GFHDSKXXPSQSLYHVPRSFLKXXEXXLVLLXEGGGNPLDISLXPVSVXDXXENFXKLPFPP 374 GRY F PSQSLYH+PR FL + LVL+ E GG+PL I++ +SV N + PP Sbjct: 619 GRYWVSFKAPSGQPSQSLYHIPRGFLTPKDNLLVLVEEMGGDPLQITVNTMSVTTVCGNVDEFSVPP 685
BLAST of HO066763 vs. TrEMBL
Match: D7SWG2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_31.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00022353001 PE=4 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.640e-9 Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = -2 Query: 201 GRYX-GFHDSKXXPSQSLYHVPRSFLKXXEXXLVLLXEGGGNPLDISLXPVSVXDXXEN 374 GRY FH+SK PSQ+LYHVPR+FLK E LVLL E G+PL ISL +S D ++ Sbjct: 655 GRYWVSFHNSKGDPSQTLYHVPRAFLKTSENLLVLLEEANGDPLHISLETISRTDLPDH 713
BLAST of HO066763 vs. TrEMBL
Match: A5AXS9_VITVI (Beta-galactosidase OS=Vitis vinifera GN=VITISV_014349 PE=3 SV=1) HSP 1 Score: 63.5438 bits (153), Expect = 7.640e-9 Identity = 33/59 (55.93%), Postives = 40/59 (67.80%), Query Frame = -2 Query: 201 GRYX-GFHDSKXXPSQSLYHVPRSFLKXXEXXLVLLXEGGGNPLDISLXPVSVXDXXEN 374 GRY FH+SK PSQ+LYHVPR+FLK E LVLL E G+PL ISL +S D ++ Sbjct: 621 GRYWVSFHNSKGDPSQTLYHVPRAFLKTSENLLVLLEEANGDPLHISLETISRTDLPDH 679
BLAST of HO066763 vs. TAIR peptide
Match: AT5G63800.1 (| Symbols: MUM2, BGAL6 | Glycosyl hydrolase family 35 protein | chr5:25530323-25535678 FORWARD LENGTH=718) HSP 1 Score: 50.8322 bits (120), Expect = 2.576e-7 Identity = 27/53 (50.94%), Postives = 33/53 (62.26%), Query Frame = -2 Query: 219 GRYX-GFHDSKXXPSQSLYHVPRSFLKXXEXXLVLLXEGGGNPLDISLXPVSV 374 GRY F PSQS+YH+PR+FLK LV+ E GG+PL ISL +SV Sbjct: 655 GRYWVSFLTPAGQPSQSIYHIPRAFLKPSGNLLVVFEEEGGDPLGISLNTISV 707
BLAST of HO066763 vs. TAIR peptide
Match: AT1G77410.1 (| Symbols: BGAL16 | beta-galactosidase 16 | chr1:29088771-29093148 REVERSE LENGTH=815) HSP 1 Score: 50.0618 bits (118), Expect = 4.393e-7 Identity = 29/56 (51.79%), Postives = 34/56 (60.71%), Query Frame = -2 Query: 213 GRYX-GFHDSKXXPSQSLYHVPRSFLKXXEXXLVLL-XEGGGNPLDISLXPVSVXD 374 GRY FH K PSQ YH+PRSFLK LV+L E GNPL I++ VSV + Sbjct: 644 GRYWVSFHTYKGNPSQIWYHIPRSFLKPNSNLLVILEEEREGNPLGITIDTVSVTE 699 The following BLAST results are available for this feature:
BLAST of HO066763 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 1
BLAST of HO066763 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of HO066763 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO066763 ID=HO066763; Name=HO066763; organism=Cicer arietinum; type=EST; length=393bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|