DY475523
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY475523 vs. TrEMBL
Match: D7T4I4_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_67.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00032741001 PE=4 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 8.516e-8 Identity = 27/35 (77.14%), Postives = 32/35 (91.43%), Query Frame = -1 Query: 148 MLRGFVVNQAGYAEKMAAVWEKLAEETATYSRDSS 252 ML+GFVVNQAGYAEKMA VWEK+AEET+ Y++D S Sbjct: 191 MLKGFVVNQAGYAEKMANVWEKVAEETSGYAKDGS 225
BLAST of DY475523 vs. TAIR peptide
Match: AT5G07120.1 (| Symbols: SNX2b | sorting nexin 2B | chr5:2207065-2209355 REVERSE LENGTH=572) HSP 1 Score: 52.7582 bits (125), Expect = 5.288e-8 Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = -1 Query: 148 MLRGFVVNQAGYAEKMAAVWEKLAEETATYSRDSS 252 M++GFV NQ GYAEK+A VW K+AEET Y R+SS Sbjct: 538 MMKGFVANQVGYAEKIANVWTKVAEETRQYDRESS 572
BLAST of DY475523 vs. TAIR peptide
Match: AT5G58440.1 (| Symbols: SNX2a | sorting nexin 2A | chr5:23624154-23626676 REVERSE LENGTH=587) HSP 1 Score: 51.9878 bits (123), Expect = 9.020e-8 Identity = 22/33 (66.67%), Postives = 27/33 (81.82%), Query Frame = -1 Query: 154 MLRGFVVNQAGYAEKMAAVWEKLAEETATYSRD 252 M++GFVVNQ GYAEKM VW K+AEET+ Y R+ Sbjct: 551 MMKGFVVNQVGYAEKMGNVWAKVAEETSQYDRE 583 The following BLAST results are available for this feature:
BLAST of DY475523 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of DY475523 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY475523 ID=DY475523; Name=DY475523; organism=Cicer arietinum; type=EST; length=255bpback to top |