GR395704
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR395704 vs. TAIR peptide
Match: AT5G08690.1 (| Symbols: | ATP synthase alpha/beta family protein | chr5:2825739-2828352 FORWARD LENGTH=556) HSP 1 Score: 50.447 bits (119), Expect = 3.282e-7 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = -3 Query: 183 GVLDGKFDGLSEPAFYLVGGIGEVLA*AGKVANESPA 293 G+LDGK+D LSE +FY+VGGI EV+A A K+A ES A Sbjct: 520 GLLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 556
BLAST of GR395704 vs. TAIR peptide
Match: AT5G08680.1 (| Symbols: | ATP synthase alpha/beta family protein | chr5:2821992-2824683 FORWARD LENGTH=559) HSP 1 Score: 50.447 bits (119), Expect = 3.282e-7 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = -3 Query: 183 GVLDGKFDGLSEPAFYLVGGIGEVLA*AGKVANESPA 293 G+LDGK+D LSE +FY+VGGI EV+A A K+A ES A Sbjct: 523 GLLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 559
BLAST of GR395704 vs. TAIR peptide
Match: AT5G08670.1 (| Symbols: | ATP synthase alpha/beta family protein | chr5:2818395-2821149 REVERSE LENGTH=556) HSP 1 Score: 50.447 bits (119), Expect = 3.282e-7 Identity = 24/37 (64.86%), Postives = 30/37 (81.08%), Query Frame = -3 Query: 183 GVLDGKFDGLSEPAFYLVGGIGEVLA*AGKVANESPA 293 G+LDGK+D LSE +FY+VGGI EV+A A K+A ES A Sbjct: 520 GLLDGKYDDLSEQSFYMVGGIDEVVAKAEKIAKESAA 556 The following BLAST results are available for this feature:
BLAST of GR395704 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR395704 ID=GR395704; Name=GR395704; organism=Cicer arietinum; type=EST; length=391bpback to top |