GR912879
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR912879 vs. TrEMBL
Match: B0WMY3_CULQU (Putative uncharacterized protein OS=Culex quinquefasciatus GN=CpipJ_CPIJ008468 PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.808e-8 Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 2 Query: 206 RIPWVXRWLLI-WRIPWVVRWLLI-WRPVNRWFLNWGLINWRLFNWWLVYGRLLNWWLINWGFLYWXLINR 412 R + W LI W ++V W L+ W VNR+ + W L+NW L N + VY L++W+L+NW + W L+NR Sbjct: 21 RSNYTVNWYLINW---YLVNWYLVNWYLVNRYQVYWYLVNWYLVNRYQVYWYLIDWYLVNWYLVNWYLVNR 88
BLAST of GR912879 vs. TrEMBL
Match: Q59T40_CANAL (Questionable orf OS=Candida albicans GN=CaO19.14167 PE=4 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 7.182e-7 Identity = 29/88 (32.95%), Postives = 42/88 (47.73%), Query Frame = 2 Query: 209 IPWVXRWLLIWRIPWVVRWLLIW--RPVNRWFLNWGLINW--RLFNWWLVYGRLLNW-----------WLINWGFLYWXLINRGFLNW 427 + W+ W++ W + WVVRW + W R RWF+ W + W R F WW V G + W W + W F+ W + R F+ W Sbjct: 6 VVWIMWWVVWWVVWWVVRWFMRWFMRWFMRWFMRW-FVGWFMRWFMWWFV-GWFMRWFMRWFMWRMMRWFVGW-FMRWFM--RWFVRW 88 The following BLAST results are available for this feature:
BLAST of GR912879 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR912879 ID=GR912879; Name=GR912879; organism=Cicer arietinum; type=EST; length=453bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|