GR394190
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR394190 vs. TrEMBL
Match: B3D9S6_BURM1 (Putative uncharacterized protein OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=BMULJ_05091 PE=4 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 6.096e-14 Identity = 42/53 (79.25%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 90 ERACSRSN*TRSQEKPLSFSL*LTVPQTDTGARDEYSKALERTQEKELGKLTP 248 ER SRSN QEKPLSFSL +TVPQTDTG RDEYSKALERT+EKELGKL P Sbjct: 38 ERLRSRSNWKWFQEKPLSFSLTMTVPQTDTGGRDEYSKALERTREKELGKLVP 90
BLAST of GR394190 vs. TrEMBL
Match: D1RK09_LEGLO (Putative uncharacterized protein OS=Legionella longbeachae D-4968 GN=LLB_2711 PE=4 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.397e-10 Identity = 41/70 (58.57%), Postives = 46/70 (65.71%), Query Frame = -2 Query: 131 INSRSHLFFAT-HSCSDVLITLLGHTFFRSYGVNLPSSFS*VLSSALEYSSRAPVSVCGTVNYKLKLSGF 337 INSRSHL A S + G TF RSYG LPSSF+ VLSSAL +S+ PVSVCGTV YKL L+ F Sbjct: 4 INSRSHLVSAALFSSESKFLHRKGRTFSRSYGTILPSSFTRVLSSALVFSTCPPVSVCGTVLYKLWLAAF 73
BLAST of GR394190 vs. TrEMBL
Match: D2YVG0_VIBMI (Putative uncharacterized protein OS=Vibrio mimicus VM573 GN=VMD_37440 PE=4 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.131e-10 Identity = 43/74 (58.11%), Postives = 49/74 (66.22%), Query Frame = -2 Query: 125 INSRSHLFFATHSCSDVLITLLGH---TFFRSYGVNLPSSFS*VLSSALEYSSRAPVSVCGTVNYKLKLSGFSW 337 +NS SHL AT S + L H TF RSYG LPSSF+ VLSSAL +S+R PVSV GT+ Y LKL GFSW Sbjct: 8 LNSCSHLVSATLVSS--IREGLHHQERTFSRSYGTILPSSFTRVLSSALVFSTRPPVSVWGTIPYNLKLRGFSW 79
BLAST of GR394190 vs. TrEMBL
Match: B9P8P2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_793758 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 4.740e-8 Identity = 27/30 (90.00%), Postives = 28/30 (93.33%), Query Frame = 3 Query: 159 TVPQTDTGARDEYSKALERTQEKELGKLTP 248 TVPQTDTG RDEYSKALERT+EKELGKL P Sbjct: 95 TVPQTDTGGRDEYSKALERTREKELGKLVP 124 HSP 2 Score: 22.3274 bits (46), Expect = 4.740e-8 Identity = 14/32 (43.75%), Postives = 16/32 (50.00%), Query Frame = 2 Query: 53 RQIRPSYTEAADRASLLAK*LNEVPGKATKLQ 148 RQIR + AK L VP KA+KLQ Sbjct: 60 RQIRARNSRMWGERPSAAKQLEVVPRKASKLQ 91
BLAST of GR394190 vs. TrEMBL
Match: C9YEE8_9BURK (Putative uncharacterized protein OS=Curvibacter putative symbiont of Hydra magnipapillata GN=Csp_D29540 PE=4 SV=1) HSP 1 Score: 50.447 bits (119), Expect = 1.021e-7 Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = -3 Query: 202 GTPSSEVTVSICRVPSPEFSQAP 270 GTPSSEVTVSICRVPSPEFSQAP Sbjct: 134 GTPSSEVTVSICRVPSPEFSQAP 156 HSP 2 Score: 29.261 bits (64), Expect = 1.021e-7 Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = -1 Query: 306 NKQSQPPIFCN 338 NKQSQPPIFCN Sbjct: 110 NKQSQPPIFCN 120
BLAST of GR394190 vs. TrEMBL
Match: C1FNC0_CLOBJ (Putative uncharacterized protein OS=Clostridium botulinum (strain Kyoto / Type A2) GN=CLM_0051 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.426e-7 Identity = 29/48 (60.42%), Postives = 32/48 (66.67%), Query Frame = -2 Query: 125 HTFFRSYGVNLPSSFS*VLSSALEYSSRAPVSVCGTVNYKLKLSGFSW 268 H F RSYGVNLPSS + +L AL +S PVSVCGT Y L GFSW Sbjct: 19 HPFSRSYGVNLPSSLTAILPMALGFSPHLPVSVCGTGTYSLD-RGFSW 65
BLAST of GR394190 vs. TrEMBL
Match: B1QFN7_CLOBO (Putative uncharacterized protein OS=Clostridium botulinum NCTC 2916 GN=CBN_0041 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 9.426e-7 Identity = 29/48 (60.42%), Postives = 32/48 (66.67%), Query Frame = -2 Query: 125 HTFFRSYGVNLPSSFS*VLSSALEYSSRAPVSVCGTVNYKLKLSGFSW 268 H F RSYGVNLPSS + +L AL +S PVSVCGT Y L GFSW Sbjct: 19 HPFSRSYGVNLPSSLTAILPMALGFSPHLPVSVCGTGTYSLD-RGFSW 65 The following BLAST results are available for this feature:
BLAST of GR394190 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 7
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR394190 ID=GR394190; Name=GR394190; organism=Cicer arietinum; type=EST; length=338bpback to top |