GR400246
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR400246 vs. TrEMBL
Match: D7SZI6_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_49.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00027840001 PE=4 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 8.204e-11 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = -3 Query: 183 SSNEVNTLKNLISQDETPTTSTIQQKSFRTFSLLSPFRSKNSEKKV 320 SS+EV+TLKNLISQDETPT T QKS R+FSLLSPFRSK S+KK+ Sbjct: 1169 SSSEVHTLKNLISQDETPTDGTTAQKSSRSFSLLSPFRSKTSDKKL 1214
BLAST of GR400246 vs. TrEMBL
Match: B9HKH7_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_803758 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 2.470e-7 Identity = 32/46 (69.57%), Postives = 37/46 (80.43%), Query Frame = -3 Query: 183 SSNEVNTLKNLISQDETPTTSTIQQKSFRTFSLLSPFRSKNSEKKV 320 SS+EV+TLKNLISQDET T + QK+ R FSLLSPFRSK EKK+ Sbjct: 1172 SSSEVHTLKNLISQDETLTAGS-NQKTSRHFSLLSPFRSKTGEKKL 1216
BLAST of GR400246 vs. TAIR peptide
Match: AT5G43310.2 (| Symbols: | COP1-interacting protein-related | chr5:17379735-17385387 REVERSE LENGTH=1180) HSP 1 Score: 54.299 bits (129), Expect = 1.800e-8 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = -3 Query: 195 SSNEVNTLKNLISQDETPTTSTIQQKSFRTFSLLSPFRSKNS 320 +++E TLKNLISQDETPT + QKS R FSLLSPF++K + Sbjct: 1137 TTSEAFTLKNLISQDETPTAAAASQKSSRHFSLLSPFKNKKT 1178
BLAST of GR400246 vs. TAIR peptide
Match: AT5G43310.1 (| Symbols: | COP1-interacting protein-related | chr5:17379735-17385387 REVERSE LENGTH=1237) HSP 1 Score: 54.299 bits (129), Expect = 1.800e-8 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = -3 Query: 195 SSNEVNTLKNLISQDETPTTSTIQQKSFRTFSLLSPFRSKNS 320 +++E TLKNLISQDETPT + QKS R FSLLSPF++K + Sbjct: 1194 TTSEAFTLKNLISQDETPTAAAASQKSSRHFSLLSPFKNKKT 1235 The following BLAST results are available for this feature:
BLAST of GR400246 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
BLAST of GR400246 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR400246 ID=GR400246; Name=GR400246; organism=Cicer arietinum; type=EST; length=343bpback to top |