GR397950
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR397950 vs. TrEMBL
Match: C6SYN9_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 62.003 bits (149), Expect = 2.244e-8 Identity = 36/74 (48.65%), Postives = 40/74 (54.05%), Query Frame = 3 Query: 78 SKLTISTSPTSERGS-----VQTSLQKAQCLCSPTTHEGSFRCRLHXXXXXXXXXXXXXIADSNDNKAVVS*NT 284 +KL +STSP S+ GS SL K QCLCSPTTHEGSFRCRLH NK VVS +T Sbjct: 8 NKLIVSTSPKSDSGSGGGGGAVGSLPKGQCLCSPTTHEGSFRCRLHRGPTASPTNWMKRSKSMPANKPVVSDST 81
BLAST of GR397950 vs. TrEMBL
Match: C6T245_SOYBN (Putative uncharacterized protein OS=Glycine max PE=4 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 3.827e-8 Identity = 30/50 (60.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 54 MASRYESR-SKLTISTSPTSERGSVQTSLQKAQCLCSPTTHEGSFRCRLH 200 MAS+ + + SKL +S P S+ G+ TS K QCLCSPTTHEGSFRCR H Sbjct: 1 MASQSQVQMSKLRVSVIPESDSGNGTTSSPKGQCLCSPTTHEGSFRCRFH 50
BLAST of GR397950 vs. TrEMBL
Match: B9ILL5_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_669299 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.998e-8 Identity = 30/47 (63.83%), Postives = 34/47 (72.34%), Query Frame = 3 Query: 72 SRSKLTISTSPTSERG----SVQTSLQKAQCLCSPTTHEGSFRCRLH 200 S KL+ISTSP S G +V +S K QCLCSPTTH+GSFRCRLH Sbjct: 3 SHGKLSISTSPESGNGERSSAVASSSPKGQCLCSPTTHQGSFRCRLH 49
BLAST of GR397950 vs. TAIR peptide
Match: AT1G67910.2 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G24577.1). | chr1:25471534-25471809 REVERSE LENGTH=91) HSP 1 Score: 49.2914 bits (116), Expect = 5.808e-7 Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 3 Query: 120 SVQTSLQKAQCLCSPTTHEGSFRCRLH 200 S QTS+ K CLCSPTTH GSFRCR+H Sbjct: 34 SRQTSMTKTNCLCSPTTHPGSFRCRIH 60
BLAST of GR397950 vs. TAIR peptide
Match: AT1G67910.1 (| Symbols: | unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G24577.1); Has 167 Blast hits to 167 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 167; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:25471534-25471809 REVERSE LENGTH=91) HSP 1 Score: 49.2914 bits (116), Expect = 5.808e-7 Identity = 20/27 (74.07%), Postives = 22/27 (81.48%), Query Frame = 3 Query: 120 SVQTSLQKAQCLCSPTTHEGSFRCRLH 200 S QTS+ K CLCSPTTH GSFRCR+H Sbjct: 34 SRQTSMTKTNCLCSPTTHPGSFRCRIH 60 The following BLAST results are available for this feature:
BLAST of GR397950 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 3
BLAST of GR397950 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR397950 ID=GR397950; Name=GR397950; organism=Cicer arietinum; type=EST; length=339bpback to top |