FE668759
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FE668759 vs. SwissProt
Match: DCAM_VICFA (S-adenosylmethionine decarboxylase proenzyme OS=Vicia faba GN=SAMDC PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 3.677e-13 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGM GSVVYQKFVK SDCGSPRSTLKCWKDEDEEE Sbjct: 319 LGMSGSVVYQKFVKASDCGSPRSTLKCWKDEDEEE 353
BLAST of FE668759 vs. SwissProt
Match: DCAM_PEA (S-adenosylmethionine decarboxylase proenzyme OS=Pisum sativum GN=SAMDC PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.383e-12 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGM GSVVYQKF+KTS CGSPRSTLKCWKDEDEEE Sbjct: 319 LGMSGSVVYQKFLKTSYCGSPRSTLKCWKDEDEEE 353
BLAST of FE668759 vs. SwissProt
Match: DCAM_DAUCA (S-adenosylmethionine decarboxylase proenzyme OS=Daucus carota GN=SAMDC PE=2 SV=1) HSP 1 Score: 53.9138 bits (128), Expect = 5.142e-7 Identity = 26/37 (70.27%), Postives = 32/37 (86.49%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSD-CGSPRSTLK-CWKDEDEEE 342 LGM GS+VYQKFVKT++ C SPRS LK CWK+E++EE Sbjct: 321 LGMDGSIVYQKFVKTTERCESPRSVLKCCWKEEEKEE 357
BLAST of FE668759 vs. TrEMBL
Match: C3TS13_CICAR (S-adenosylmethionine decarboxylase OS=Cicer arietinum PE=1 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 2.478e-13 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE Sbjct: 319 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 353
BLAST of FE668759 vs. TrEMBL
Match: B7FFN8_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.521e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGGSVVYQKFVKT+DCGSPRSTLKCWKDEDEEE Sbjct: 168 LGMGGSVVYQKFVKTADCGSPRSTLKCWKDEDEEE 202
BLAST of FE668759 vs. TrEMBL
Match: A4ULG0_MEDFA (S-adenosylmethionine decarboxylase OS=Medicago falcata GN=SAMDC PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 5.521e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGGSVVYQKFVKT+DCGSPRSTLKCWKDEDEEE Sbjct: 319 LGMGGSVVYQKFVKTADCGSPRSTLKCWKDEDEEE 353
BLAST of FE668759 vs. TrEMBL
Match: D7RJM3_ARAHY (S-adenosylmethionine decarboxylase OS=Arachis hypogaea GN=SAMDC PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.674e-12 Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 +GMGGSVVYQKFVKTSDCGSPRSTLKCWKDE EEE Sbjct: 324 IGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEVEEE 358
BLAST of FE668759 vs. TrEMBL
Match: Q8S3F8_SOYBN (S-adenosylmethionine decarboxylase OS=Glycine max GN=SAMDC PE=1 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.776e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGGSVVYQKF KTSDCGSPRSTLKCW +EDEEE Sbjct: 321 LGMGGSVVYQKFGKTSDCGSPRSTLKCWNEEDEEE 355
BLAST of FE668759 vs. TrEMBL
Match: C6TAM1_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.776e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGGSVVYQKF KTSDCGSPRSTLKCW +EDEEE Sbjct: 138 LGMGGSVVYQKFGKTSDCGSPRSTLKCWNEEDEEE 172
BLAST of FE668759 vs. TrEMBL
Match: Q76KV7_PEA (S-adenosylmethionine decarboxylase (Fragment) OS=Pisum sativum GN=SAMDC PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 3.030e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGM GSVVYQKF+KTS CGSPRSTLKCWKDEDEEE Sbjct: 245 LGMSGSVVYQKFLKTSYCGSPRSTLKCWKDEDEEE 279
BLAST of FE668759 vs. TrEMBL
Match: Q8W3Y2_PHALU (S-adenosylmethionine decarboxylase OS=Phaseolus lunatus GN=SAMDC PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.462e-10 Identity = 31/35 (88.57%), Postives = 31/35 (88.57%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLKCWKDEDEEE 342 LGMGG VVYQKFVK SDC SPRSTLKCWKDE EEE Sbjct: 320 LGMGGFVVYQKFVKISDCVSPRSTLKCWKDEVEEE 354
BLAST of FE668759 vs. TrEMBL
Match: B9RLB5_RICCO (S-adenosylmethionine decarboxylase, putative OS=Ricinus communis GN=RCOM_1464770 PE=1 SV=1) HSP 1 Score: 62.7734 bits (151), Expect = 1.407e-8 Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLK-CWKDEDEEE 342 LGMGGS+VYQKFV+T D GSPRSTLK CW++E+EEE Sbjct: 324 LGMGGSIVYQKFVRTGDSGSPRSTLKCCWREEEEEE 359
BLAST of FE668759 vs. TrEMBL
Match: Q852S9_MALDO (S-adenosylmethionine decarboxylase OS=Malus domestica GN=SAMDC PE=1 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 9.122e-8 Identity = 25/36 (69.44%), Postives = 33/36 (91.67%), Query Frame = -3 Query: 238 LGMGGSVVYQKFVKTSDCGSPRSTLK-CWKDEDEEE 342 LG+GG++VYQ+F+KT CGSPRSTLK CW++E+EEE Sbjct: 321 LGLGGAIVYQRFLKTERCGSPRSTLKGCWREEEEEE 356 The following BLAST results are available for this feature:
BLAST of FE668759 vs. SwissProt
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Swissprot) Total hits: 3
BLAST of FE668759 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FE668759 ID=FE668759; Name=FE668759; organism=Cicer arietinum; type=EST; length=515bpback to top |