HO064638
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO064638 vs. TrEMBL
Match: B9RCB4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1686550 PE=4 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 4.742e-11 Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = -3 Query: 18 GRKEEAKKPPKSEIRPQNPVTLREEAIGKIKTKPIT--NTKSHLRIEHLKKLAVWATTDPHIPSLGAFYGQHLATVSEAAGVP 260 G+K KKPP + ++LR+E G+I+ K T N KS L++EHL+ L++W + IPSL AF+G+ LA EA G P Sbjct: 2 GKKGGIKKPPYTPTPSHTSISLRQETTGRIQAKGATVRNPKSFLKLEHLQNLSLWTAREASIPSLSAFFGRQLAAAGEALGFP 84
BLAST of HO064638 vs. TrEMBL
Match: B9SUR0_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0627370 PE=4 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.353e-10 Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = -3 Query: 21 GRKEEAKKPPKSEIRPQNPVTLREEAIGKIKTK--PITNTKSHLRIEHLKKLAVWATTDPHIPSLGAFYGQHLATVSEAAGV 260 G++ KK P + ++LR+E G+I+TK + N KS L++EHL+ L+VWA+ + IPSL AF+G+ A EA G+ Sbjct: 2 GKRGGTKKQPDTPTPSHKSISLRQETTGRIQTKGASVRNPKSFLKLEHLQNLSVWASREASIPSLSAFFGRQFAAAGEALGL 83 The following BLAST results are available for this feature:
BLAST of HO064638 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO064638 ID=HO064638; Name=HO064638; organism=Cicer arietinum; type=EST; length=547bpback to top |