ES560411
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of ES560411 vs. TrEMBL
Match: A2Q3E0_MEDTR (DNA-directed RNA polymerase, 14 to 18 kDa subunit OS=Medicago truncatula GN=MtrDRAFT_AC155881g13v1 PE=3 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 1.152e-12 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 NKNDD+ EGEPIETE+KED P ERPR+TSKYMTKYERARIL Sbjct: 33 NKNDDLDAEGEPIETEEKEDAAPVERPRRTSKYMTKYERARIL 75
BLAST of ES560411 vs. TrEMBL
Match: B7FHE6_MEDTR (Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 4.378e-12 Identity = 34/42 (80.95%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARI 185 NKNDD+ EGEPIETE+KED P ERPR+TSKYMTKYERARI Sbjct: 33 NKNDDLDAEGEPIETEEKEDVAPVERPRRTSKYMTKYERARI 74
BLAST of ES560411 vs. TrEMBL
Match: C6SWG7_SOYBN (Putative uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 2.402e-10 Identity = 33/43 (76.74%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 NKND++TGE I+TEDKE+E+P +RPRKTSKYMTKYERARIL Sbjct: 32 NKNDEITGES--IDTEDKEEEQPVKRPRKTSKYMTKYERARIL 72
BLAST of ES560411 vs. TrEMBL
Match: B9ID35_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_824910 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 6.989e-10 Identity = 33/43 (76.74%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 N N+D TGE PIETEDKE++ P ERPRKTSK+MTKYERARIL Sbjct: 33 NNNEDDTGE--PIETEDKEEQAPVERPRKTSKFMTKYERARIL 73
BLAST of ES560411 vs. TrEMBL
Match: B9I4C9_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_814294 PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 1.557e-9 Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 N DD +GEPIETEDKE++ P ERPRKTSK+MTKYERARIL Sbjct: 34 NNEDD---KGEPIETEDKEEQEPVERPRKTSKFMTKYERARIL 73
BLAST of ES560411 vs. TrEMBL
Match: B9R9F9_RICCO (DNA-directed RNA polymerase subunit rpb6, putative OS=Ricinus communis GN=RCOM_1496830 PE=3 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 2.656e-9 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 3 Query: 60 NKNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 N N+D+ G+ PIETEDKE++ ERPRKTSKYMTKYERARIL Sbjct: 14 NNNEDVPGD--PIETEDKEEQEAAERPRKTSKYMTKYERARIL 54
BLAST of ES560411 vs. TrEMBL
Match: D7MRK7_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_495261 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 5.009e-8 Identity = 29/42 (69.05%), Postives = 35/42 (83.33%), Query Frame = 3 Query: 63 KNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 +NDD+ GE P+ETEDK + P +RPRKTSK+MTKYERARIL Sbjct: 35 ENDDVNGE--PLETEDKVETEPVQRPRKTSKFMTKYERARIL 74
BLAST of ES560411 vs. TrEMBL
Match: D7L835_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_899271 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 6.541e-8 Identity = 29/42 (69.05%), Postives = 35/42 (83.33%), Query Frame = 3 Query: 63 KNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 +NDD+ GE P+ETEDK + P +RPRKTSK+MTKYERARIL Sbjct: 35 ENDDVNGE--PMETEDKVETEPVQRPRKTSKFMTKYERARIL 74
BLAST of ES560411 vs. TrEMBL
Match: Q9FJ98_ARATH (DNA-directed RNA polymerase II subunit-like protein OS=Arabidopsis thaliana GN=At5g51940 PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.116e-7 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 63 KNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 +NDD+ GE PIE EDK + P +RPRKTSK+MTKYERARIL Sbjct: 35 ENDDVNGE--PIEAEDKVETEPVQRPRKTSKFMTKYERARIL 74
BLAST of ES560411 vs. TAIR peptide
Match: AT5G51940.1 (| Symbols: NRPB6A, NRPD6A, NRPE6A | RNA polymerase Rpb6 | chr5:21104679-21105796 FORWARD LENGTH=144) HSP 1 Score: 59.6918 bits (143), Expect = 4.256e-10 Identity = 29/42 (69.05%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 63 KNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 +NDD+ GE PIE EDK + P +RPRKTSK+MTKYERARIL Sbjct: 35 ENDDVNGE--PIEAEDKVETEPVQRPRKTSKFMTKYERARIL 74
BLAST of ES560411 vs. TAIR peptide
Match: AT2G04630.1 (| Symbols: NRPB6B, NRPE6B | RNA polymerase Rpb6 | chr2:1619168-1620246 REVERSE LENGTH=144) HSP 1 Score: 56.225 bits (134), Expect = 4.705e-9 Identity = 27/42 (64.29%), Postives = 34/42 (80.95%), Query Frame = 3 Query: 63 KNDDMTGEGEPIETEDKEDERPGERPRKTSKYMTKYERARIL 188 +NDD+ + P+ETEDK + P +RPRKTSK+MTKYERARIL Sbjct: 35 ENDDVNVD--PLETEDKVETEPVQRPRKTSKFMTKYERARIL 74 The following BLAST results are available for this feature:
BLAST of ES560411 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 9
BLAST of ES560411 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >ES560411 ID=ES560411; Name=ES560411; organism=Cicer arietinum; type=EST; length=191bpback to top Annotated Terms
The
following terms have been associated with
this EST:
|