DR749502

EST Overview
NameDR749502
Unique NameDR749502
TypeEST
OrganismCicer arietinum (chickpea)
Sequence length312
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
Cicer arietinum unigene v12010-12-27
Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide2011-02-03
Homology Analysis: Cicer arietinum unigene v1 vs Trembl2010-12-28
InterProScan analysis for Cicer arietinum unigene v12010-12-29
Unigenes
This EST is part of the following unigenes:
Unigene NameAnalysis NameSequence type in Unigene
Cicer arietinum unigene v1Cicer arietinum unigene v1EST
Homology
BLAST of DR749502 vs. TrEMBL
Match: D7SX51_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_241.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00004910001 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.638e-17
Identity = 52/83 (62.65%), Postives = 60/83 (72.29%), Query Frame = -1
Query:   61 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEA 309
            TV+ CE+F ESGVAELVSAMAAGWNAQLIVETWS+GG+I TSVGLA         +      V L   DE+SRSEY ++MGEA
Sbjct:   17 TVKTCELFQESGVAELVSAMAAGWNAQLIVETWSQGGLIATSVGLA------IASRNSCGRHVCL-VPDEQSRSEYVEAMGEA 92          
BLAST of DR749502 vs. TrEMBL
Match: B9RBS4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1680280 PE=4 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.086e-16
Identity = 50/83 (60.24%), Postives = 57/83 (68.67%), Query Frame = -1
Query:   61 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEA 309
            TV++CEIF ES VAELVSAMAAGW A LIVETWS GGVI TS+GLA         +      V +   DERSR++YAK MGEA
Sbjct:   17 TVKSCEIFQESSVAELVSAMAAGWKANLIVETWSHGGVIATSIGLA------IASRHAGGRHVCI-VPDERSRTDYAKVMGEA 92          

HSP 2 Score: 22.3274 bits (46), Expect = 1.086e-16
Identity = 10/20 (50.00%), Postives = 13/20 (65.00%), Query Frame = -3
Query:   20 KKHGRSGMSPEIMVGNRMEL 79
            K  G +GM PEI+VG   E+
Sbjct:   87 KVMGEAGMLPEIIVGEPEEV 106          
BLAST of DR749502 vs. TrEMBL
Match: B9RBS8_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1680620 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.362e-16
Identity = 49/83 (59.04%), Postives = 57/83 (68.67%), Query Frame = -1
Query:   61 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEA 309
            TV++CEIF ES VAEL+SAMAAGW A LIVETWS GGVI TS+GLA         +      V +   DERSR++YAK MGEA
Sbjct:   17 TVKSCEIFQESSVAELLSAMAAGWKANLIVETWSHGGVIATSIGLA------IASRHAGGRHVCI-VPDERSRTDYAKVMGEA 92          

HSP 2 Score: 22.3274 bits (46), Expect = 2.362e-16
Identity = 10/20 (50.00%), Postives = 13/20 (65.00%), Query Frame = -3
Query:   20 KKHGRSGMSPEIMVGNRMEL 79
            K  G +GM PEI+VG   E+
Sbjct:   87 KVMGEAGMLPEIIVGEPEEV 106          
BLAST of DR749502 vs. TrEMBL
Match: B9GVS6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_554240 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.482e-15
Identity = 46/83 (55.42%), Postives = 59/83 (71.08%), Query Frame = -1
Query:   61 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEA 309
            TV++CE+F ES VAEL+SAMAAGWNA+LIVETWS+GG++ TS+GLA +A      + V          DE SRSEY ++M EA
Sbjct:   17 TVKSCEVFQESSVAELISAMAAGWNAKLIVETWSQGGILATSIGLA-IASRHTDGRHVCVVP------DELSRSEYEEAMAEA 92          

HSP 2 Score: 22.3274 bits (46), Expect = 1.482e-15
Identity = 9/15 (60.00%), Postives = 12/15 (80.00%), Query Frame = -3
Query:   20 SGMSPEIMVGNRMEL 64
            +GMSPEI+VG   E+
Sbjct:   92 AGMSPEIIVGEAEEV 106          
BLAST of DR749502 vs. TrEMBL
Match: B9N3M3_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_784359 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.037e-13
Identity = 44/92 (47.83%), Postives = 63/92 (68.48%), Query Frame = -1
Query:   34 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEAVCRRKLWLG 309
            TV++CE+  ES VAEL+SAMAAGWNA+LI+ETWS+GG++ TS+GLA +A      + V          DE SRS+Y +++GEA    ++ +G
Sbjct:   17 TVKSCEVHQESSVAELISAMAAGWNAKLILETWSQGGILATSIGLA-IASRRTDGRHVCIVP------DELSRSQYEEAVGEAGISPEIIIG 101          
BLAST of DR749502 vs. TrEMBL
Match: B9IBZ1_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_572101 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 8.781e-13
Identity = 44/81 (54.32%), Postives = 55/81 (67.90%), Query Frame = -1
Query:   70 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTL-DERSRSEYAKSM 309
            T++ CE F ES VAEL+SAMAAGWNA+LIVE+WS+GG I TS+GLA  A     +        H+  + DE SRSEY K+M
Sbjct:   17 TIKTCENFIESSVAELLSAMAAGWNAKLIVESWSKGGPIATSIGLAVAAHHTCGR--------HVCVVPDEGSRSEYVKTM 89          
BLAST of DR749502 vs. TrEMBL
Match: B9GPF6_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_552041 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.147e-12
Identity = 47/86 (54.65%), Postives = 55/86 (63.95%), Query Frame = -1
Query:   52 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTLDERSRSEYAKSMGEAVCR 309
            TV+ CE F ES VAEL+SAMAAGWNA+LIVE+WS+ G I TS+GLA  A      K      V +   DE SRSEY K+M  A  R
Sbjct:   17 TVKTCEDFKESSVAELLSAMAAGWNAKLIVESWSKAGPIATSIGLAVAA------KHTCGRHVCV-VPDEGSRSEYVKAMHGAGMR 95          
BLAST of DR749502 vs. TrEMBL
Match: B9PBA2_POPTR (Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_581836 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.498e-12
Identity = 44/81 (54.32%), Postives = 54/81 (66.67%), Query Frame = -1
Query:   70 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTL-DERSRSEYAKSM 309
            TV+ CE F ES VAEL+SAMAAGWNA+LIVE+WS+ G I TS+GLA  A     +        H+  + DE SRSEY K+M
Sbjct:   17 TVKTCEDFKESSVAELLSAMAAGWNAKLIVESWSKAGPIATSIGLAVAAHHTCGR--------HVCVVPDEGSRSEYVKTM 89          
BLAST of DR749502 vs. TrEMBL
Match: D7U7U2_VITVI (Whole genome shotgun sequence of line PN40024, scaffold_48.assembly12x (Fragment) OS=Vitis vinifera GN=VIT_00027632001 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.555e-12
Identity = 41/84 (48.81%), Postives = 56/84 (66.67%), Query Frame = -1
Query:   61 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTL-DERSRSEYAKSMGEA 309
            TV++ E+F +SGVAEL++AMA GWNA++IVETWS GGV+ TS GLA  A     +        H+  + DERS+  Y K+M +A
Sbjct:   17 TVKSSEVFKQSGVAELIAAMAGGWNAKMIVETWSHGGVVTTSAGLAIAASHTCGR--------HVCIVPDERSKLAYIKAMHDA 92          
BLAST of DR749502 vs. TrEMBL
Match: D7LRU3_ARALY (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_486550 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.709e-12
Identity = 44/86 (51.16%), Postives = 53/86 (61.63%), Query Frame = -1
Query:   58 HTVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTL-DERSRSEYAKSMGEAV 312
            HTV++C+ + ES VAE +SA AAGWN +LIVETWSRG  I TSVGLA  A        +     H+  + DE SRSEY   M  AV
Sbjct:   16 HTVRSCKSYRESSVAEFLSATAAGWNTRLIVETWSRGDPIATSVGLAVAA--------IHTCGRHVCIVPDEESRSEYEAVMKGAV 93          
BLAST of DR749502 vs. TAIR peptide
Match: AT3G60780.1 (| Symbols: | Protein of unknown function (DUF1442) | chr3:22462695-22463630 FORWARD LENGTH=218)

HSP 1 Score: 72.0182 bits (175), Expect = 8.270e-14
Identity = 43/86 (50.00%), Postives = 53/86 (61.63%), Query Frame = -1
Query:   58 HTVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLGTL-DERSRSEYAKSMGEAV 312
            HTV++C+ + +S VAE +SA AAGWN +LIVETWSRG  I TSVGLA  A        +     H+  + DE SRSEY   M  AV
Sbjct:   16 HTVRSCKSYRDSSVAEFLSATAAGWNTRLIVETWSRGDPIATSVGLAVAA--------IHTCGRHVCIVPDEESRSEYEAVMRGAV 93          
BLAST of DR749502 vs. TAIR peptide
Match: AT2G45360.1 (| Symbols: | Protein of unknown function (DUF1442) | chr2:18698619-18699360 FORWARD LENGTH=215)

HSP 1 Score: 68.1662 bits (165), Expect = 1.194e-12
Identity = 42/86 (48.84%), Postives = 50/86 (58.14%), Query Frame = -1
Query:   70 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGLAPLAGVPFPKKPVWKTRVHLG------TLDERSRSEYAKSM 309
            TV++C+   ESGVAE +SA AAGWNA+LIVETWSRG  I TSVGLA  A              H G        DE+S+ EY  +M
Sbjct:   17 TVKSCKSDKESGVAEFLSATAAGWNARLIVETWSRGDPITTSVGLAVAA-------------THTGGRHVCIVPDEQSKLEYVLAM 89          
BLAST of DR749502 vs. TAIR peptide
Match: AT1G62840.1 (| Symbols: | Protein of unknown function (DUF1442) | chr1:23271481-23272407 FORWARD LENGTH=224)

HSP 1 Score: 62.003 bits (149), Expect = 8.558e-11
Identity = 30/45 (66.67%), Postives = 33/45 (73.33%), Query Frame = -1
Query:  175 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGL 309
            TV++CE     G AELV+AMAAGWNA LIVETWS G  I  SVGL
Sbjct:   17 TVKSCENLGTPGAAELVAAMAAGWNANLIVETWSEGETIAISVGL 61          
BLAST of DR749502 vs. TAIR peptide
Match: AT1G12320.1 (| Symbols: | Protein of unknown function (DUF1442) | chr1:4189424-4190209 FORWARD LENGTH=212)

HSP 1 Score: 58.5362 bits (140), Expect = 9.462e-10
Identity = 26/45 (57.78%), Postives = 33/45 (73.33%), Query Frame = -1
Query:  175 TVQACEIFNESGVAELVSAMAAGWNAQLIVETWSRGGVIPTSVGL 309
            TV++CE       AEL++AMAAGWN +LIVETWS G  I +S+GL
Sbjct:   17 TVKSCENLETPDAAELIAAMAAGWNVKLIVETWSEGDAIASSIGL 61          
The following BLAST results are available for this feature:
BLAST of DR749502 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl)
Total hits: 10
Match NameE-valueIdentityDescription
D7SX51_VITVI2.638e-1762.65Whole genome shotgun sequence of line PN40024, sca... [more]
B9RBS4_RICCO1.086e-1660.24Putative uncharacterized protein OS=Ricinus commun... [more]
B9RBS8_RICCO2.362e-1659.04Putative uncharacterized protein OS=Ricinus commun... [more]
B9GVS6_POPTR1.482e-1555.42Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9N3M3_POPTR1.037e-1347.83Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9IBZ1_POPTR8.781e-1354.32Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9GPF6_POPTR1.147e-1254.65Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
B9PBA2_POPTR1.498e-1254.32Predicted protein OS=Populus trichocarpa GN=POPTRD... [more]
D7U7U2_VITVI2.555e-1248.81Whole genome shotgun sequence of line PN40024, sca... [more]
D7LRU3_ARALY9.709e-1251.16Putative uncharacterized protein OS=Arabidopsis ly... [more]
back to top
BLAST of DR749502 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide)
Total hits: 4
Match NameE-valueIdentityDescription
AT3G60780.18.270e-1450.00| Symbols: | Protein of unknown function (DUF1442... [more]
AT2G45360.11.194e-1248.84| Symbols: | Protein of unknown function (DUF1442... [more]
AT1G62840.18.558e-1166.67| Symbols: | Protein of unknown function (DUF1442... [more]
AT1G12320.19.462e-1057.78| Symbols: | Protein of unknown function (DUF1442... [more]
back to top
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009902Protein of unknown function DUF1442PFAMPF07279DUF1442coord: 1..87
score: 3.1

Properties
Property NameValue
Singlet in analysisCicer arietinum unigene v1
Sequences
The following sequences are available for this feature:

EST sequence

>DR749502 ID=DR749502|Name=DR749502|organism=Cicer arietinum|type=EST|length=312bp
TACGCCGATATAACGTCCATAACTCCATCCGGTTCCCAACCATAATTTCC
GGCGACATACCGCTTCTCCCATGCTTTTTGCATACTCTGATCTCGACCGT
TCATCCAAGGTACCTAAATGCACACGTGTCTTCCACACCGGTTTTTTTGG
GAACGGAACTCCGGCTAATGGGGCTAAACCCACACTCGTTGGGATAACTC
CGCCACGTGACCATGTTTCCACTATAAGCTGCGCGTTCCATCCCGCTGCC
ATAGCAGATACTAGCTCCGCCACTCCAGATTCATTGAAAATCTCACAAGC
TTGAACTGTGTG
back to top
Annotated Terms
The following terms have been associated with this EST:
Vocabulary: INTERPRO
TermDefinition
IPR009902DUF1442