CK148743
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK148743 vs. TAIR peptide
Match: AT3G13640.1 (| Symbols: ATRLI1, RLI1 | RNAse l inhibitor protein 1 | chr3:4458751-4461323 REVERSE LENGTH=603) HSP 1 Score: 50.447 bits (119), Expect = 2.625e-7 Identity = 26/31 (83.87%), Postives = 26/31 (83.87%), Query Frame = 3 Query: 102 MSDRLTRIAIVSNDRCKP--CRQECKKRPCP 188 MSDRLTRIAIVS DRCKP CRQECKK CP Sbjct: 1 MSDRLTRIAIVSEDRCKPKKCRQECKK-SCP 30
BLAST of CK148743 vs. TAIR peptide
Match: AT4G19210.1 (| Symbols: ATRLI2, RLI2 | RNAse l inhibitor protein 2 | chr4:10501906-10504776 FORWARD LENGTH=605) HSP 1 Score: 49.6766 bits (117), Expect = 4.477e-7 Identity = 25/31 (80.65%), Postives = 27/31 (87.10%), Query Frame = 3 Query: 102 MSDRLTRIAIVSNDRCKP--CRQECKKRPCP 188 M+DRLTRIAIVS+DRCKP CRQECKK CP Sbjct: 1 MADRLTRIAIVSSDRCKPKKCRQECKK-SCP 30 The following BLAST results are available for this feature:
BLAST of CK148743 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK148743 ID=CK148743; Name=CK148743; organism=Cicer arietinum; type=EST; length=257bpback to top |