GR399555
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GR399555 vs. TrEMBL
Match: B8LLL2_PICSI (Putative uncharacterized protein OS=Picea sitchensis PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 5.261e-9 Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*EM 718 + D HEWIN+IPT IY L PRERAW N+RGKKT +S TL RL EM Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTLVRLCEM 54
BLAST of GR399555 vs. TrEMBL
Match: A9U511_PHYPA (Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_102363 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 5.261e-9 Identity = 31/49 (63.27%), Postives = 35/49 (71.43%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*EM 718 + D HEWIN+IPT IY L PRERAW N+RGKKT +S TL RL EM Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWKNQRGKKTLLSLTLVRLCEM 54
BLAST of GR399555 vs. TrEMBL
Match: C5WN92_SORBI (Putative uncharacterized protein Sb01g024170 OS=Sorghum bicolor GN=Sb01g024170 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 4.454e-8 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*EM 718 + D HEWIN+IPT +Y PRERAW N+RGKKT +S TL RL EM Sbjct: 6 ISDAHEWINEIPTVPVYYPAKPQPRERAWRNQRGKKTLLSLTLVRLCEM 54
BLAST of GR399555 vs. TrEMBL
Match: C1NAN0_MICPS (Predicted protein OS=Micromonas pusilla CCMP1545 GN=MICPUCDRAFT_23907 PE=4 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 4.454e-8 Identity = 29/49 (59.18%), Postives = 34/49 (69.39%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*EM 718 + D HEWIN+IPT +Y PRERAW N+RGKKT +S TL RL EM Sbjct: 6 ISDAHEWINEIPTVPVYYPAKPQPRERAWQNQRGKKTLLSLTLVRLCEM 54
BLAST of GR399555 vs. TrEMBL
Match: B6SZV7_MAIZE (Putative uncharacterized protein OS=Zea mays PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 1.296e-7 Identity = 28/49 (57.14%), Postives = 33/49 (67.35%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*EM 718 + D HEWIN+ PT +Y PRERAW N+RGKKT +S TL RL EM Sbjct: 6 ISDAHEWINEFPTVPVYYPAKPQPRERAWRNQRGKKTLLSLTLVRLCEM 54
BLAST of GR399555 vs. TrEMBL
Match: A8NF35_BRUMA (Transcription factor, putative OS=Brugia malayi GN=Bm1_01210 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 1.296e-7 Identity = 29/46 (63.04%), Postives = 32/46 (69.57%), Query Frame = 2 Query: 578 DPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTLSRL*E 715 D HEWIN+IPT IY L PRERAW +RGKKT +S TL RL E Sbjct: 8 DAHEWINEIPTVPIYYLAKPQPRERAWQTQRGKKTLLSLTLVRLCE 53
BLAST of GR399555 vs. TrEMBL
Match: A7RYT6_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g223461 PE=4 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 1.296e-7 Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTL 700 + D HEWIN+IPT IY L PRERAW+N+RGKKT +S TL Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWHNQRGKKTLLSLTL 48
BLAST of GR399555 vs. TrEMBL
Match: A3LSK2_PICST (Predicted protein OS=Pichia stipitis GN=PICST_31083 PE=4 SV=2) HSP 1 Score: 60.8474 bits (146), Expect = 1.296e-7 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTL 700 + D HEWIN+IPT IY L PRERAW N+RGKKT +S TL Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTSLSLTL 48
BLAST of GR399555 vs. TrEMBL
Match: B3SDD3_TRIAD (Putative uncharacterized protein OS=Trichoplax adhaerens GN=TRIADDRAFT_33902 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 1.692e-7 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTL 700 + D HEWIN+IPT IY L PRERAW N+RGKKT +S TL Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTL 48
BLAST of GR399555 vs. TrEMBL
Match: A7SPZ0_NEMVE (Predicted protein OS=Nematostella vectensis GN=v1g126575 PE=4 SV=1) HSP 1 Score: 60.4622 bits (145), Expect = 1.692e-7 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 2 Query: 572 LCDPHEWINQIPTGSIYDLTNTTPRERAWNNRRGKKTRMSSTL 700 + D HEWIN+IPT IY L PRERAW N+RGKKT +S TL Sbjct: 6 ISDAHEWINEIPTVPIYYLAKPQPRERAWQNQRGKKTLLSLTL 48 The following BLAST results are available for this feature:
BLAST of GR399555 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 10
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >GR399555 ID=GR399555; Name=GR399555; organism=Cicer arietinum; type=EST; length=731bpback to top |