rna-TanjilR_06410
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
Homology
BLAST of rna-TanjilR_06410 vs. DB:Swiss
Match: P24B3_ARATH (Transmembrane emp24 domain-containing protein p24beta3 OS=Arabidopsis thaliana OX=3702 GN=At3g22845 PE=2 SV=1) HSP 1 Score: 103.605 bits (257), Expect = 7.663e-56 Identity = 47/62 (75.81%), Postives = 51/62 (82.26%), Query Frame = 2 Query: 341 VTAPDGTMAYALKGVSGEKFELKALHHGIYKFCFHNPVSTPETVSFYIHVGHIPNEHDLAKD 526 VT+P G + LKG SG+KFE KA G+YKFCFHNP STPETVSFYIHVGHIPNEHDLAKD Sbjct: 73 VTSPAGNIVQTLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKD 134 HSP 2 Score: 84.7297 bits (208), Expect = 7.663e-56 Identity = 37/67 (55.22%), Postives = 51/67 (76.12%), Query Frame = 1 Query: 31 VITFIGTIICHGL----ALSISLNDVECVSEYIANEGDIISGNFIVMDHDIFWGSDHPGIDFSVSYP 219 V IG I+ + + +LS+++ND ECV EY+ EGD +SGNF+V+DHDIFWGSDHPG+DF+V+ P Sbjct: 10 VFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSDHPGLDFTVTSP 76 HSP 3 Score: 72.0182 bits (175), Expect = 7.663e-56 Identity = 32/38 (84.21%), Postives = 37/38 (97.37%), Query Frame = 3 Query: 645 EHLDPINVKIAELREALESVISEQKYLKARDARHRYSN 758 EHLDP+NVKIAELREALESV++EQKYLKARD RHR++N Sbjct: 135 EHLDPVNVKIAELREALESVVAEQKYLKARDTRHRHTN 172 The following BLAST results are available for this feature:
BLAST of rna-TanjilR_06410 vs. DB:Swiss
Analysis Date: 2020-01-28 (BLAST: L. angustifolius cv. Tanjil genome v1.0 vs. Swissprot) Total hits: 1
InterPro
Analysis Name: InterProScan: L. angustifolius cv. Tanjil genome v1.0
Date Performed: 2020-01-28
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-TanjilR_06410_La_Tanjil_v1.0 ID=rna-TanjilR_06410_La_Tanjil_v1.0; Name=rna-TanjilR_06410; organism=Lupinus angustifolius; type=mRNA; length=767bpback to top protein sequence of rna-TanjilR_06410_La_Tanjil_v1.0 >rna-TanjilR_06410_La_Tanjil_v1.0 ID=rna-TanjilR_06410_La_Tanjil_v1.0; Name=rna-TanjilR_06410_La_Tanjil_v1.0; organism=Lupinus angustifolius; type=polypeptide; length=171bpback to top mRNA from alignment at Chr_LG09-CM007369.1:8098011..8098777- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>rna-TanjilR_06410_La_Tanjil_v1.0 ID=rna-TanjilR_06410_La_Tanjil_v1.0; Name=rna-TanjilR_06410; organism=Lupinus angustifolius; type=mRNA; length=767bp; location=Sequence derived from: Chr_LG09-CM007369.1:8098011..8098777- (Lupinus angustifoliusback to top Coding sequence (CDS) from alignment at Chr_LG09-CM007369.1:8098011..8098777- >rna-TanjilR_06410_La_Tanjil_v1.0 ID=rna-TanjilR_06410_La_Tanjil_v1.0; Name=rna-TanjilR_06410; organism=Lupinus angustifolius; type=CDS; length=516bp; location=Sequence derived from: Chr_LG09-CM007369.1:8098011..8098777- (Lupinus angustifoliusback to top |