rna-TanjilR_30714
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs Gene/transcripts from the same species that appear to represent the same gene
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Homology
BLAST of rna-TanjilR_30714 vs. DB:Swiss
Match: Y4213_ARATH (ER membrane protein complex subunit 7 homolog OS=Arabidopsis thaliana OX=3702 GN=At4g32130 PE=2 SV=1) HSP 1 Score: 65.0846 bits (157), Expect = 1.645e-23 Identity = 30/40 (75.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 7783 VRVDVSARNPGKIQAALTETRRGLSEFVLEPLKGEQYYEV 7902 VRVDVSAR+ GK+QA LTETRR L+E VLEPL+ EQYYE+ Sbjct: 100 VRVDVSARHRGKVQATLTETRRSLTELVLEPLRAEQYYEM 139 HSP 2 Score: 45.0542 bits (105), Expect = 1.645e-23 Identity = 20/23 (86.96%), Postives = 20/23 (86.96%), Query Frame = 2 Query: 7619 HNVPAGTHLIEVAALGYFFSPVN 7687 H VPAGTHLIEV ALGYFFSPV Sbjct: 79 HKVPAGTHLIEVYALGYFFSPVR 101 HSP 3 Score: 45.0542 bits (105), Expect = 1.645e-23 Identity = 32/43 (74.42%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 7992 YYLVL*QIREPFSIMSIVKSPMGLMMGFMLIVVFLMPKLMENM 8120 YY ++REPFS+MSIVKSPMGLM+GFM++VVFLMPKLMEN+ Sbjct: 136 YY----EMREPFSVMSIVKSPMGLMVGFMVVVVFLMPKLMENI 174 The following BLAST results are available for this feature:
BLAST of rna-TanjilR_30714 vs. DB:Swiss
Analysis Date: 2020-01-28 (BLAST: L. angustifolius cv. Tanjil genome v1.0 vs. Swissprot) Total hits: 1 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan: L. angustifolius cv. Tanjil genome v1.0
Date Performed: 2020-01-28 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >rna-TanjilR_30714_La_Tanjil_v1.0 ID=rna-TanjilR_30714_La_Tanjil_v1.0; Name=rna-TanjilR_30714; organism=Lupinus angustifolius; type=mRNA; length=8858bpback to top protein sequence of rna-TanjilR_30714_La_Tanjil_v1.0 >rna-TanjilR_30714_La_Tanjil_v1.0 ID=rna-TanjilR_30714_La_Tanjil_v1.0; Name=rna-TanjilR_30714_La_Tanjil_v1.0; organism=Lupinus angustifolius; type=polypeptide; length=515bpback to top mRNA from alignment at Chr_LG03-CM007363.1:23277951..23286808+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>rna-TanjilR_30714_La_Tanjil_v1.0 ID=rna-TanjilR_30714_La_Tanjil_v1.0; Name=rna-TanjilR_30714; organism=Lupinus angustifolius; type=mRNA; length=8858bp; location=Sequence derived from: Chr_LG03-CM007363.1:23277951..23286808+ (Lupinus angustifoliusback to top Coding sequence (CDS) from alignment at Chr_LG03-CM007363.1:23277951..23286808+ >rna-TanjilR_30714_La_Tanjil_v1.0 ID=rna-TanjilR_30714_La_Tanjil_v1.0; Name=rna-TanjilR_30714; organism=Lupinus angustifolius; type=CDS; length=1548bp; location=Sequence derived from: Chr_LG03-CM007363.1:23277951..23286808+ (Lupinus angustifoliusback to top |