LR48_mrnaVigan01g256600
Transcript Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Orthologs
Syntenic blocks Orthologs
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following start_codon feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following stop_codon feature(s) are a part of this mRNA:
Homology
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1B_ARATH (Mitotic-spindle organizing protein 1B OS=Arabidopsis thaliana OX=3702 GN=GIP1 PE=1 SV=1) HSP 1 Score: 92.8189 bits (229), Expect = 9.674e-26 Identity = 45/52 (86.54%), Postives = 47/52 (90.38%), Query Frame = 1 Query: 1 MDSEAARAARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 MD EA+R ARESL+L F MSNILDTGLDRHTLSVLIALCDLGVNPEALA VV Sbjct: 1 MDEEASRTARESLELVFRMSNILDTGLDRHTLSVLIALCDLGVNPEALATVV 52
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1A_ARATH (Mitotic-spindle organizing protein 1A OS=Arabidopsis thaliana OX=3702 GN=GIP2 PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 6.566e-23 Identity = 40/52 (76.92%), Postives = 46/52 (88.46%), Query Frame = 1 Query: 1 MDSEAARAARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 M+ EAA ARESL+L F MSNIL+TGLDRHTLSVLIALCD+G+NPEALA +V Sbjct: 1 MNQEAAETARESLELVFRMSNILETGLDRHTLSVLIALCDIGLNPEALATLV 52
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_PICSI (Mitotic-spindle organizing protein 1 OS=Picea sitchensis OX=3332 PE=3 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 9.412e-22 Identity = 41/52 (78.85%), Postives = 45/52 (86.54%), Query Frame = 1 Query: 1 MDSEAARAARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 MD AA+ ARESLDLAF +SN L TGLDRHTLS+LIALC+ GVNPEALAAVV Sbjct: 1 MDRTAAQNARESLDLAFSISNFLQTGLDRHTLSILIALCEHGVNPEALAAVV 52
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_TAEGU (Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata OX=59729 GN=mzt1 PE=3 SV=1) HSP 1 Score: 58.9214 bits (141), Expect = 2.439e-12 Identity = 28/54 (51.85%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 1 MDSEAA--RAARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 M S AA A RE++D+ F +S IL+TGLD TLS+ + LC+ G+NPEAL++V+ Sbjct: 1 MASNAASLNAVRETMDVLFEISRILNTGLDMETLSICVRLCEQGINPEALSSVI 54
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_HUMAN (Mitotic-spindle organizing protein 1 OS=Homo sapiens OX=9606 GN=MZT1 PE=1 SV=2) HSP 1 Score: 56.6102 bits (135), Expect = 2.883e-11 Identity = 23/45 (51.11%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 22 AARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 A RE++D+ +S IL+TGLD TLS+ + LC+ G+NPEAL++V+ Sbjct: 20 AVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVI 64
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_MOUSE (Mitotic-spindle organizing protein 1 OS=Mus musculus OX=10090 GN=Mzt1 PE=1 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 4.375e-11 Identity = 23/45 (51.11%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 22 AARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 A RE++D+ +S IL+TGLD TLS+ + LC+ G+NPEAL++V+ Sbjct: 17 AVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVI 61
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_XENTR (Mitotic-spindle organizing protein 1 OS=Xenopus tropicalis OX=8364 GN=mzt1 PE=3 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 7.218e-11 Identity = 22/45 (48.89%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 22 AARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 A RE++D+ +S +L+TGLD TLS+ + LC+ G+NPEAL++V+ Sbjct: 10 AVRETMDVLLEISRLLNTGLDMETLSICVRLCEQGINPEALSSVI 54
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_XENLA (Mitotic-spindle organizing protein 1 OS=Xenopus laevis OX=8355 GN=mzt1 PE=3 SV=2) HSP 1 Score: 55.0694 bits (131), Expect = 9.485e-11 Identity = 22/45 (48.89%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 22 AARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 A RE++D+ +S +L+TGLD TLS+ + LC+ G+NPEAL++V+ Sbjct: 10 AVRETMDVLLEISRLLNTGLDMETLSICVRLCEQGINPEALSSVI 54
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_DANRE (Mitotic-spindle organizing protein 1 OS=Danio rerio OX=7955 GN=mzt1 PE=3 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 3.734e-10 Identity = 21/45 (46.67%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 22 AARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 A RE++D+ +S +L+TGLD +LS+ + LC+ G+NPEAL++V+ Sbjct: 11 AVRETMDVLLEISRLLNTGLDMESLSICVRLCEQGINPEALSSVI 55
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Match: MZT1_CRYNJ (Mitotic-spindle organizing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNA01750 PE=3 SV=1) HSP 1 Score: 51.2174 bits (121), Expect = 2.678e-9 Identity = 21/46 (45.65%), Postives = 33/46 (71.74%), Query Frame = 1 Query: 19 RAARESLDLAFHMSNILDTGLDRHTLSVLIALCDLGVNPEALAAVV 156 R ARE++D + +S +L TGLD+ TLS+ + + + G NP+ LAAV+ Sbjct: 11 RNARETIDSLYDLSQLLQTGLDKSTLSICVGMIEQGANPDTLAAVI 56 The following BLAST results are available for this feature:
BLAST of LR48_mrnaVigan01g256600 vs. DB:Swiss
Analysis Date: 2020-05-21 (BLAST: V. angularis Jingnong 6 genome v1.1) Total hits: 10 Position : 0 Zoom : x 1
InterPro
Analysis Name: InterProScan: Vigna angularis Jingnong 6 genome v1.1
Date Performed: 2020-05-21 Position : 0 Zoom : x 1
Sequences
The
following sequences are available for this feature:
mRNA sequence >LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1 ID=LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1; Name=LR48_mrnaVigan01g256600; organism=Vigna angularis; type=mRNA; length=222bpback to top protein sequence of LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1 >LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1 ID=LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1; Name=LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1; organism=Vigna angularis; type=polypeptide; length=73bpback to top mRNA from alignment at Chr_1-CM003371.1:34099256..34099477+ Legend: polypeptidestart_codonexonCDSstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.>LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1 ID=LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1; Name=LR48_mrnaVigan01g256600; organism=Vigna angularis; type=mRNA; length=222bp; location=Sequence derived from: Chr_1-CM003371.1:34099256..34099477+ (Vigna angularisback to top Coding sequence (CDS) from alignment at Chr_1-CM003371.1:34099256..34099477+ >LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1 ID=LR48_mrnaVigan01g256600_Va_Jingnong6_v1.1; Name=LR48_mrnaVigan01g256600; organism=Vigna angularis; type=CDS; length=222bp; location=Sequence derived from: Chr_1-CM003371.1:34099256..34099477+ (Vigna angularisback to top Annotated Terms
The
following terms have been associated with
this mRNA:
|