HO067887
EST Overview
Libraries
Unigenes
This EST is part of the following unigenes:
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of HO067887 vs. TrEMBL
Match: B7FJ95_MEDTR (Putative uncharacterized protein (Fragment) OS=Medicago truncatula PE=2 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.122e-7 Identity = 31/60 (51.67%), Postives = 35/60 (58.33%), Query Frame = 2 Query: 2 GSPRRGG-IXXXXXXXXXXXXXXXXXXXXXXVYDRYSGPDRRRSPDYGRHRSPEYGRYRS 178 GSPRRGG + VYDRY+GPDRRRSPDYGR+ SP+YGR RS Sbjct: 173 GSPRRGGGLARSPSPGYRRRPSPDYGRPRSPVYDRYTGPDRRRSPDYGRNGSPDYGRNRS 232
BLAST of HO067887 vs. TAIR peptide
Match: AT3G61860.1 (| Symbols: ATRSP31, RSP31, At-RS31, RS31 | RNA-binding (RRM/RBD/RNP motifs) family protein | chr3:22900311-22902159 REVERSE LENGTH=264) HSP 1 Score: 50.8322 bits (120), Expect = 4.232e-7 Identity = 28/46 (60.87%), Postives = 29/46 (63.04%), Query Frame = 2 Query: 95 YDRYSGP---DRRRSPDYG-------RHRSPEYGRYRSGSPVRRSR 202 YDRY GP +RRRSPDYG R RSP Y RYRS SPV R R Sbjct: 218 YDRYKGPAAYERRRSPDYGRRSSDYGRQRSPGYDRYRSRSPVPRGR 263 The following BLAST results are available for this feature:
BLAST of HO067887 vs. TrEMBL
Analysis Date: 2010-12-28 (Homology Analysis: Cicer arietinum unigene v1 vs Trembl) Total hits: 1
BLAST of HO067887 vs. TAIR peptide
Analysis Date: 2011-02-03 (Homology Analysis: Cicer arietinum unigene v1 vs TAIR 10 peptide) Total hits: 1
InterPro
Analysis Name: InterProScan analysis for Cicer arietinum unigene v1
Date Performed: 2010-12-29
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >HO067887 ID=HO067887; Name=HO067887; organism=Cicer arietinum; type=EST; length=483bpback to top |